Glyma04g06970 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g06970

Feature Type:	gene_model
Chromosome:	Gm04
Start:	5391544
stop:	5392483
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g06970

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G45180	AT	Annotation by Michelle Graham. TAIR10: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein \| chr2:18626377-18626781 FORWARD LENGTH=134	SoyBase	E_val: 2.00E-36	ISS
GO:0000038	GO-bp	Annotation by Michelle Graham. GO Biological Process: very long-chain fatty acid metabolic process	SoyBase	N/A	ISS
GO:0006869	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid transport	SoyBase	N/A	ISS
GO:0042335	GO-bp	Annotation by Michelle Graham. GO Biological Process: cuticle development	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0008289	GO-mf	Annotation by Michelle Graham. GO Molecular Function: lipid binding	SoyBase	N/A	ISS
PF00234	PFAM	Protease inhibitor/seed storage/LTP family	JGI		ISS
UniRef100_G7I723	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 14 kDa proline-rich protein DC2.15 n=1 Tax=Medicago truncatula RepID=G7I723_MEDTR	SoyBase	E_val: 4.00E-49	ISS
UniRef100_I1JUB4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JUB4_SOYBN	SoyBase	E_val: 6.00E-109	ISS

Expression Patterns of Glyma04g06970

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g06970

Paralog	Evidence	Comments
Glyma06g07070	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g06970 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g065600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g06970

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g06970

Limit To All Plant Sequences

>Glyma04g06970.1   sequence type=CDS   gene model=Glyma04g06970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCCAACAAACTCCTGGCCACCATTTTGGTGCTTTCTCTCCTCTCTTACTCAACATTCACTCATGCCAATTGCCCACCACCCACTCCATCTCCAAAGCCCACACCACCAACTCCAATACCAACACCACCCACACCAAAGCCCACACCACCCACTCCAAAGCCCACACCACCAACTCCTAAGCCCACACCACCCACACCAAATCCCACACCACCTACTCCAAAGCCTAGTTGTCCTCCTCCTTCTCCTCCTTCACCACCATCAAACAAAGCCTCATGCCCCAAGGACACATTAAAGCTAGGTGCTTGTGCTGATCTCTTAGGACTTGTTAACATTATTGTTGGAACTCCTCCTTCGAGCCAGTGTTGTGCATTGATCAAGGGTTTGGCGGATTTGGAAGCTGCACTTTGCCTATGCACCGCAATTAAGAGCAATGTGCTTGGAATCAACTTGAACGTACCTGTGACGCTCAGCGTGATCCTTAGTGCTTGTCAAAAGACTGTCCCTCCTGGTTTCCAATGTCCCTCCTGA

Predicted protein sequences of Glyma04g06970

Limit To All Plant Sequences

>Glyma04g06970.1   sequence type=predicted peptide   gene model=Glyma04g06970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASNKLLATILVLSLLSYSTFTHANCPPPTPSPKPTPPTPIPTPPTPKPTPPTPKPTPPTPKPTPPTPNPTPPTPKPSCPPPSPPSPPSNKASCPKDTLKLGACADLLGLVNIIVGTPPSSQCCALIKGLADLEAALCLCTAIKSNVLGINLNVPVTLSVILSACQKTVPPGFQCPS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain