Glyma04g06950 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g06950

Feature Type:	gene_model
Chromosome:	Gm04
Start:	5368418
stop:	5371674
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g06950

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G05500	AT	Annotation by Michelle Graham. TAIR10: Calcium-dependent lipid-binding (CaLB domain) family protein \| chr1:1625098-1628940 FORWARD LENGTH=560	SoyBase	E_val: 2.00E-71	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0016126	GO-bp	Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process	SoyBase	N/A	ISS
GO:0019745	GO-bp	Annotation by Michelle Graham. GO Biological Process: pentacyclic triterpenoid biosynthetic process	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0012505	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endomembrane system	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PTHR10774	Panther	CALCIUM-DEPENDENT LIPID-BINDING PROTEIN (CALB RELATED)	JGI		ISS
PTHR10774:SF23	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00168	PFAM	C2 domain	JGI		ISS
UniRef100_G7JAG6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Synaptotagmin-1 n=1 Tax=Medicago truncatula RepID=G7JAG6_MEDTR	SoyBase	E_val: 5.00E-75	ISS
UniRef100_UPI0002339991	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002339991 related cluster n=1 Tax=unknown RepID=UPI0002339991	SoyBase	E_val: 2.00E-139	ISS

Expression Patterns of Glyma04g06950

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g06950

Paralog	Evidence	Comments
Glyma06g07030	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g06950 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma04g06950

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g06950

Limit To All Plant Sequences

>Glyma04g06950.1   sequence type=CDS   gene model=Glyma04g06950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CCTGCTTTTGGAGCTGTTTACTTTTCCTTGAAAGAGAAGAGAGATCTGGATTTTACTCTCAAGGTTATTGGTGGCGATTTATCAACTTTACCGGGGATATCTGATGCTATAGAGGAAACAATTAGAGATGCCATTGAAGACTCTATAACTTGGCCAGTACGCAAAGTTATACCAATTCTACCCGGGGATTACAGTAATCTAGAGTTGAAACCGGTTGGAATACTAGAAGTAAAACTAGTGCAAGCTAAGAACTTAACAAATAAAGATATAATTGGGAAATCCGATCCTTATGCTGTCATATTTGTACGCCCCCTCCGTGACAGAACCAAAACCAAACAACCAGTTGAATTCATTATTGAAGATGCGTCAACGCAGCACTTGACGGACCTTGAACCTGGTAAAGTCAAGGACGTGTGGCTTAAGCTGGTTAAGGATTTGGAGGTCCATAGAGATAACGAAATGTTAATTCTTGAAGTCTACGATCATGATACGTTTGGCAAGGAAAAAATTGGAAGAGTGATCTTGACACTGACCAAGGTCATCTTAGAAGGGGAATACAATGAAACTTATCCTCTAGATGGCGCTAAATCGGGAAATATTTCTTTGCATTTGAAGTGGACTCCACAGCACAATTTTCGGGATCCTTAG

Predicted protein sequences of Glyma04g06950

Limit To All Plant Sequences

>Glyma04g06950.1   sequence type=predicted peptide   gene model=Glyma04g06950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
PAFGAVYFSLKEKRDLDFTLKVIGGDLSTLPGISDAIEETIRDAIEDSITWPVRKVIPILPGDYSNLELKPVGILEVKLVQAKNLTNKDIIGKSDPYAVIFVRPLRDRTKTKQPVEFIIEDASTQHLTDLEPGKVKDVWLKLVKDLEVHRDNEMLILEVYDHDTFGKEKIGRVILTLTKVILEGEYNETYPLDGAKSGNISLHLKWTPQHNFRDP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain