Report for Sequence Feature Glyma04g06920
Feature Type: gene_model
Chromosome: Gm04
Start: 5351048
stop: 5354207
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g06920
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G25310 AT
Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF2012) | chr2:10777436-10779123 REVERSE LENGTH=210
SoyBase E_val: 8.00E-91 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005783 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0030246 GO-mf
Annotation by Michelle Graham. GO Molecular Function: carbohydrate binding
SoyBase N/A ISS
KOG3306
KOG
Predicted membrane protein
JGI ISS
PTHR13605 Panther
UNCHARACTERIZED
JGI ISS
PF09430 PFAM
Protein of unknown function (DUF2012)
JGI ISS
UniRef100_I1JUA9 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JUA9_SOYBN
SoyBase E_val: 3.00E-150 ISS
UniRef100_Q8VY97 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: ER membrane protein complex subunit 7 homolog n=1 Tax=Arabidopsis thaliana RepID=Y4213_ARATH
SoyBase E_val: 5.00E-81 ISS
Expression Patterns of Glyma04g06920
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma04g06920
Paralog Evidence Comments
Glyma06g07000 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g06920 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g065200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g06920
Coding sequences of Glyma04g06920
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g06920.1 sequence type=CDS gene model=Glyma04g06920 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTTCAACCAGATCAGTCTTTCTTCTTCTTTTCATTCAATTGTGCTTCTCACTTCTACCCTTGTCATTCGCTCAATCCCCCGCCACCGGGTCTACCGAAGGTTACACCATTTATGGTCGAGTGAAGATCCCCAGTGTGGGAACAAAAGATTATATTCTTCCTGGAAAAATTTCAAATGTCAAAGTCATACTCAATGGTGGTCAAAGAGTTACTTTTCTGAGGCCTGATGGATATTTCTCATTCCACAATGTTCCTGCAGGGACACATCTAATTGAAGTGGCTGCCATAGGCTATTTCTTTTCTCCGGTACGAGTTGATGTAAGTGCCAGACACCATGGCAAAATTCAGGCAGCCCTGACAGAAAATAGGAGGGGGCTAAGTGAGTTTGTCTTGGAGCCATTGAAGGATGAACAATATTTTGAGGTTAGGGAGCCATTCTCTATTATGTCCATTGTGAAAAGTCCAATGGGTCTGATGATGGGATTTATGCTGATTGTTGTCTTCCTCATGCCCAAATTAATGGAGAACATGGATCCAGAAGAAATGAGGCGTGCACAAGAAGAAATGAGAAATCAAGGAGTTCCATCTTTAGCAAGCCTGTTACCCGGTGCTGCAAGAAGCAACTAG
Predicted protein sequences of Glyma04g06920
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g06920.1 sequence type=predicted peptide gene model=Glyma04g06920 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MASTRSVFLLLFIQLCFSLLPLSFAQSPATGSTEGYTIYGRVKIPSVGTKDYILPGKISNVKVILNGGQRVTFLRPDGYFSFHNVPAGTHLIEVAAIGYFFSPVRVDVSARHHGKIQAALTENRRGLSEFVLEPLKDEQYFEVREPFSIMSIVKSPMGLMMGFMLIVVFLMPKLMENMDPEEMRRAQEEMRNQGVPSLASLLPGAARSN*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
