Report for Sequence Feature Glyma04g06860
Feature Type: gene_model
Chromosome: Gm04
Start: 5309731
stop: 5311773
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g06860
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G11090 AT
Annotation by Michelle Graham. TAIR10: serine-rich protein-related | chr5:3524796-3525449 FORWARD LENGTH=217
SoyBase E_val: 2.00E-72 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1JUA4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JUA4_SOYBN
SoyBase E_val: 6.00E-153 ISS
UniRef100_Q8L8M8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Serine-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q8L8M8_ARATH
SoyBase E_val: 2.00E-65 ISS
Expression Patterns of Glyma04g06860
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma04g06860
Paralog Evidence Comments
Glyma06g06951 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g06860 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g064600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g06860
Coding sequences of Glyma04g06860
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g06860.1 sequence type=CDS gene model=Glyma04g06860 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTTCCTCGTCTTCCAGAACTAAGTCCAGTGGGCCCGTTCTACGCTCCCTCTCACCCTCCAGTAGATTCTGCTCATACACCACATCCAAAACCCCTTTCTCTTCTCCTTCATCCGCATTCGCTTCCTCCACAAGCTCTGGCTTCTCCTCTTCAACCTTCTTCAACCAGCCACGTCAGCATCACTCTCAAAGCCATCACAGCCACCACCGTGCCGCATCGCCCACACGTGTCAATCTATACAGCCCCGCCCCTCTCTCTTCCGGCGTCCGGTTCTCTATCGACCCCCGGTCTATATCACCCAACCGGTCCATATCGAACCAGATCATCACGACGAAGAACAACCGTCCGATCTCTGGCCAGAAGAAGACGTGTATGTGCTCGCCTACGATGCACCCTGGCTCGTTCCGATGCAGCCTCCACAAGAACATCGGGAACAACAACCACCACTCCGATTCATACCCCTCGAATCGGCTTAACATGCGTAGATCTGCTATGAAGAACTCGCTCGTGAGAATCGGAGGCGTGGAGGGCGAGTGGGTGAAACGGGCCCTGACAGCACTGATTCGGCCCAGTTCGCATCAACAGAGGAGGAGAGCGGGGTTCGAGCCCAGGCCCAGTCGTCTCTCTGTCATGTCCAAAGCCCAGGATCTATGA
Predicted protein sequences of Glyma04g06860
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g06860.1 sequence type=predicted peptide gene model=Glyma04g06860 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MASSSSRTKSSGPVLRSLSPSSRFCSYTTSKTPFSSPSSAFASSTSSGFSSSTFFNQPRQHHSQSHHSHHRAASPTRVNLYSPAPLSSGVRFSIDPRSISPNRSISNQIITTKNNRPISGQKKTCMCSPTMHPGSFRCSLHKNIGNNNHHSDSYPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQRRRAGFEPRPSRLSVMSKAQDL*