SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g06830

Feature Type:gene_model
Chromosome:Gm04
Start:5293474
stop:5294776
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g06830
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G64870AT Annotation by Michelle Graham. TAIR10: SPFH/Band 7/PHB domain-containing membrane-associated protein family | chr5:25929776-25931308 REVERSE LENGTH=479 SoyBaseE_val: 3.00E-22ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009873GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR13806Panther FLOTILLIN-RELATED JGI ISS
PTHR13806:SF3Panther gb def: cog2268:uncharacterized bcr [corynebacterium glutamicum] JGI ISS
UniRef100_Q9ZTB2UniRef Annotation by Michelle Graham. Best UniRef hit: Nodulin n=1 Tax=Glycine max RepID=Q9ZTB2_SOYBN SoyBaseE_val: 2.00E-25ISS
UniRef100_Q9ZTB2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Nodulin n=1 Tax=Glycine max RepID=Q9ZTB2_SOYBN SoyBaseE_val: 2.00E-25ISS

Expression Patterns of Glyma04g06830
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g06830
ParalogEvidenceComments
Glyma06g06930 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g06830 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g064400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g06830
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g06830
>Glyma04g06830.1   sequence type=CDS   gene model=Glyma04g06830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTACAGGGTAGCAAACGCTTCCGAATACCTTGTGATCACTGGGGTTGGAATCACAGACATAAAGCTTGCAAAGAAAGCATGGGTTCTCTCAGGCCACTCATGCACCGTCTTCGACCTCTCTCCGGTCAACTACACCTTCGAAGTTCAGGCCATGAGGTTAAGGTGTTTGAGGCTGTGGTGGCAGAGGCCAATTCCTCAGCAAAGCAGAGTGTTGAGTATGAAACCAAGGTTAGATTCTTTCTTCTTAATTTTACAATTTAATACATCGTATTACTCAGTTTGTGTTCACTAA
Predicted protein sequences of Glyma04g06830
>Glyma04g06830.1   sequence type=predicted peptide   gene model=Glyma04g06830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYRVANASEYLVITGVGITDIKLAKKAWVLSGHSCTVFDLSPVNYTFEVQAMRLRCLRLWWQRPIPQQSRVLSMKPRLDSFFLILQFNTSYYSVCVH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo