SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma04g06681

Feature Type:gene_model
Chromosome:Gm04
Start:5141205
stop:5142222
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G11000AT Annotation by Michelle Graham. TAIR10: Plant protein of unknown function (DUF868) | chr5:3479166-3480335 REVERSE LENGTH=389 SoyBaseE_val: 9.00E-59ISS
GO:0006857GO-bp Annotation by Michelle Graham. GO Biological Process: oligopeptide transport SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF05910PFAM Plant protein of unknown function (DUF868) JGI ISS
UniRef100_I1K8Q1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K8Q1_SOYBN SoyBaseE_val: 2.00E-171ISS
UniRef100_Q9LEU1UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT5g11000/T30N20_270 n=1 Tax=Arabidopsis thaliana RepID=Q9LEU1_ARATH SoyBaseE_val: 4.00E-56ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g06681 not represented in the dataset

Glyma04g06681 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g06770 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g062800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g06681.1   sequence type=CDS   gene model=Glyma04g06681   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCTCATCCCCGTTCCCTTCTTGCTTCCGCCCCTCCCCCAACGCCGAATCCCACCCTCCTCCCCCTCCGCCGCCGCACTCCACAATCTCCAACCTCACAATCTACCACACCGACACAGGCCCCGTGTCCCTAACATGGTCACGCTCCATTGTTGGACGCTCCCTCCACATTCAGCTCCACCAAAACCCCTTAGATTCCCCACCCTACCCTAACCCTAACCCTAACCCCTCCCCCTCCACCACCCTCTCCTTCCACCTCCACATAAGACCCTTCCTCTTCTGGAAAAAACACGGTTCCAAAAAACTCGCCCCCAACACCCACCTCTTCTGGAACCTCTCCAGAGCCAAATTCGGCGCCACCCCCGAACCCCTCTCCGGCTTCTACGTCGCCCTAGTAGTCCACAACCACATGACCCTCCTCATCGGAGACGCCGCCAGAGACGCGTTTTCAAAGTCCAAGGCGCGCCACCCAAACACGCCGCAACTCCTCCTCCTAAAAAAAGAACGCGTCTTTGCCGACAGGCTGTACACCACGCGCGCCAGGTTCGGAGGGAAAGCGCCGCTGAAGTGGAAGTTCAGAGGGAACGAGCGGGTTCAGGTGGACGGCGTGCACGTGCAAATCTCGTGGGACCTTTATAACTGGCTGTTTGACAAGAACAACAACAGCAGCAGTGGCGCCGACGCGCACGCCATTTTCATGTTCAAATTCGAGGAGGACGAGGTTGAGGCGGTCGGGGGGGATAGGAACAACCTGGTTGCGCTGTGGAATTTGGGGGCTTCGGAATGGGGCAAGACTTGGTCCTCTTCTTCGCTGTCGTCTTCCGGTGGGTCTTTCGGTGGAAGCTCCTCCGTCTTGGAATGGTCCAGTGTGGAGGAGAATGAGTTGGTCGTTCCTGTTGGTTTCTCTCTGCTCGTTTACGCTTGGAAACGCTGA

>Glyma04g06681.1   sequence type=predicted peptide   gene model=Glyma04g06681   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSSPFPSCFRPSPNAESHPPPPPPPHSTISNLTIYHTDTGPVSLTWSRSIVGRSLHIQLHQNPLDSPPYPNPNPNPSPSTTLSFHLHIRPFLFWKKHGSKKLAPNTHLFWNLSRAKFGATPEPLSGFYVALVVHNHMTLLIGDAARDAFSKSKARHPNTPQLLLLKKERVFADRLYTTRARFGGKAPLKWKFRGNERVQVDGVHVQISWDLYNWLFDKNNNSSSGADAHAIFMFKFEEDEVEAVGGDRNNLVALWNLGASEWGKTWSSSSLSSSGGSFGGSSSVLEWSSVEENELVVPVGFSLLVYAWKR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo