Glyma04g06681 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g06681

Feature Type:	gene_model
Chromosome:	Gm04
Start:	5141205
stop:	5142222
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g06681

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G11000	AT	Annotation by Michelle Graham. TAIR10: Plant protein of unknown function (DUF868) \| chr5:3479166-3480335 REVERSE LENGTH=389	SoyBase	E_val: 9.00E-59	ISS
GO:0006857	GO-bp	Annotation by Michelle Graham. GO Biological Process: oligopeptide transport	SoyBase	N/A	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0048767	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair elongation	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF05910	PFAM	Plant protein of unknown function (DUF868)	JGI		ISS
UniRef100_I1K8Q1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K8Q1_SOYBN	SoyBase	E_val: 2.00E-171	ISS
UniRef100_Q9LEU1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AT5g11000/T30N20_270 n=1 Tax=Arabidopsis thaliana RepID=Q9LEU1_ARATH	SoyBase	E_val: 4.00E-56	ISS

Expression Patterns of Glyma04g06681

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g06681 not represented in the dataset	Glyma04g06681 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g06681

Paralog	Evidence	Comments
Glyma06g06770	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g06681 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g062800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g06681

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g06681

Limit To All Plant Sequences

>Glyma04g06681.1   sequence type=CDS   gene model=Glyma04g06681   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCTCATCCCCGTTCCCTTCTTGCTTCCGCCCCTCCCCCAACGCCGAATCCCACCCTCCTCCCCCTCCGCCGCCGCACTCCACAATCTCCAACCTCACAATCTACCACACCGACACAGGCCCCGTGTCCCTAACATGGTCACGCTCCATTGTTGGACGCTCCCTCCACATTCAGCTCCACCAAAACCCCTTAGATTCCCCACCCTACCCTAACCCTAACCCTAACCCCTCCCCCTCCACCACCCTCTCCTTCCACCTCCACATAAGACCCTTCCTCTTCTGGAAAAAACACGGTTCCAAAAAACTCGCCCCCAACACCCACCTCTTCTGGAACCTCTCCAGAGCCAAATTCGGCGCCACCCCCGAACCCCTCTCCGGCTTCTACGTCGCCCTAGTAGTCCACAACCACATGACCCTCCTCATCGGAGACGCCGCCAGAGACGCGTTTTCAAAGTCCAAGGCGCGCCACCCAAACACGCCGCAACTCCTCCTCCTAAAAAAAGAACGCGTCTTTGCCGACAGGCTGTACACCACGCGCGCCAGGTTCGGAGGGAAAGCGCCGCTGAAGTGGAAGTTCAGAGGGAACGAGCGGGTTCAGGTGGACGGCGTGCACGTGCAAATCTCGTGGGACCTTTATAACTGGCTGTTTGACAAGAACAACAACAGCAGCAGTGGCGCCGACGCGCACGCCATTTTCATGTTCAAATTCGAGGAGGACGAGGTTGAGGCGGTCGGGGGGGATAGGAACAACCTGGTTGCGCTGTGGAATTTGGGGGCTTCGGAATGGGGCAAGACTTGGTCCTCTTCTTCGCTGTCGTCTTCCGGTGGGTCTTTCGGTGGAAGCTCCTCCGTCTTGGAATGGTCCAGTGTGGAGGAGAATGAGTTGGTCGTTCCTGTTGGTTTCTCTCTGCTCGTTTACGCTTGGAAACGCTGA

Predicted protein sequences of Glyma04g06681

Limit To All Plant Sequences

>Glyma04g06681.1   sequence type=predicted peptide   gene model=Glyma04g06681   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSSPFPSCFRPSPNAESHPPPPPPPHSTISNLTIYHTDTGPVSLTWSRSIVGRSLHIQLHQNPLDSPPYPNPNPNPSPSTTLSFHLHIRPFLFWKKHGSKKLAPNTHLFWNLSRAKFGATPEPLSGFYVALVVHNHMTLLIGDAARDAFSKSKARHPNTPQLLLLKKERVFADRLYTTRARFGGKAPLKWKFRGNERVQVDGVHVQISWDLYNWLFDKNNNSSSGADAHAIFMFKFEEDEVEAVGGDRNNLVALWNLGASEWGKTWSSSSLSSSGGSFGGSSSVLEWSSVEENELVVPVGFSLLVYAWKR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain