SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g06615

Feature Type:gene_model
Chromosome:Gm04
Start:5066271
stop:5066502
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g06615
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATMG00090AT Annotation by Michelle Graham. TAIR10: structural constituent of ribosome;protein binding | chrM:25482-28733 REVERSE LENGTH=556 SoyBaseE_val: 1.00E-16ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005763GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial small ribosomal subunit SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
UniRef100_E5DM97UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein S3 (Fragment) n=1 Tax=Melianthus major RepID=E5DM97_MELMA SoyBaseE_val: 1.00E-17ISS
UniRef100_E5DM97UniRef Annotation by Michelle Graham. Best UniRef hit: Ribosomal protein S3 (Fragment) n=1 Tax=Melianthus major RepID=E5DM97_MELMA SoyBaseE_val: 1.00E-17ISS

Expression Patterns of Glyma04g06615
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g06615 not represented in the dataset
Glyma04g06615 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g06615 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma04g06615
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g06615
>Glyma04g06615.1   sequence type=CDS   gene model=Glyma04g06615   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCGCAGCGCAAAAGAACTTGGCGAGTCGATCAGGCTCATCGACCGGGAAAAGCAAAACGAAATTCGGATTTGGCCGAAAAAGAAGCAACGCTATGGATACGATGACCGATCATCATCGATAAAGAAGAACCTTTCTAAATCACTTCGGGTCAACAAGGGAACTACATATCAAAAAGACCGGATTCCATTTAGTTCCAAAGACTAG
Predicted protein sequences of Glyma04g06615
>Glyma04g06615.1   sequence type=predicted peptide   gene model=Glyma04g06615   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRSAKELGESIRLIDREKQNEIRIWPKKKQRYGYDDRSSSIKKNLSKSLRVNKGTTYQKDRIPFSSKD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo