SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma04g06410

Feature Type:gene_model
Chromosome:Gm04
Start:4890961
stop:4892282
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G25060AT Annotation by Michelle Graham. TAIR10: early nodulin-like protein 14 | chr2:10662308-10662930 FORWARD LENGTH=182 SoyBaseE_val: 5.00E-57ISS
GO:0000226GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization SoyBaseN/AISS
GO:0000911GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation SoyBaseN/AISS
GO:0016572GO-bp Annotation by Michelle Graham. GO Biological Process: histone phosphorylation SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
GO:0046658GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
PF02298PFAM Plastocyanin-like domain JGI ISS
UniRef100_C6SVL3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SVL3_SOYBN SoyBaseE_val: 6.00E-127ISS
UniRef100_G7J9U0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Early nodulin-like protein n=1 Tax=Medicago truncatula RepID=G7J9U0_MEDTR SoyBaseE_val: 3.00E-81ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g06450 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g060600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g06410.2   sequence type=CDS   gene model=Glyma04g06410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTTCTCCCCTGTTCTTCATCACACCATAAATGCAACACTCCAAACACCCCCACTAATGCAAACCCACCACTTTGTGCTTGTGTGTGCAAGAAAGGTAAAAGCTTTCACACACCCTTTTCACTTCTCAAAAAACAAAAGGCCATGGCTGGTTCCTCTGCTTCTCTTTTGTTCCTTTTCCTTCTCTTTGGATTCTCAGCAGCTAAGGAGCTATTGGTTGGAGGCAAAATAGATGCTTGGAAGATTCCATCTTCTGAATCAGATACCCTCAATCAATGGGCTGAAAGGTCTCGTTTCAGAGTGGGCGATCATCTAGTGTGGAAATATGAGAGTGGGAAGGACTCAGTGTTGGAAGTAACAAGGGAAGATTATGCTAATTGCAGCACATCCAACCCCATCAAAGAGTACAATGATGGAAACACTAAGGTGAAGCTTGAACATCCTGGTCCATTTTACTTCATCAGTGGATCAAAGGGGCACTGTGAGAAGGGGCAAAAGTTGATTGTGGTGGTAATGTCTCCAAGGCACACATTCACTGCCATTATTTCTCCAGCACCAACACCTTCTCCAGCAGAGTTCGAGGGTCCCGCTGTTGCTCCTACTAGCAGTGCCACAACGTTTCAAGTTGGCCTTCTCACTGCTCTTGGAGTTTTGGCTATTTATGTGGGTTTTCTCATGTAA

>Glyma04g06410.2   sequence type=predicted peptide   gene model=Glyma04g06410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
FLPCSSSHHKCNTPNTPTNANPPLCACVCKKGKSFHTPFSLLKKQKAMAGSSASLLFLFLLFGFSAAKELLVGGKIDAWKIPSSESDTLNQWAERSRFRVGDHLVWKYESGKDSVLEVTREDYANCSTSNPIKEYNDGNTKVKLEHPGPFYFISGSKGHCEKGQKLIVVVMSPRHTFTAIISPAPTPSPAEFEGPAVAPTSSATTFQVGLLTALGVLAIYVGFLM*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo