Report for Sequence Feature Glyma04g06410
Feature Type: gene_model
Chromosome: Gm04
Start: 4890961
stop: 4892282
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g06410
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G25060 AT
Annotation by Michelle Graham. TAIR10: early nodulin-like protein 14 | chr2:10662308-10662930 FORWARD LENGTH=182
SoyBase E_val: 5.00E-57 ISS
GO:0000226 GO-bp
Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization
SoyBase N/A ISS
GO:0000911 GO-bp
Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation
SoyBase N/A ISS
GO:0016572 GO-bp
Annotation by Michelle Graham. GO Biological Process: histone phosphorylation
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0009506 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma
SoyBase N/A ISS
GO:0031225 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane
SoyBase N/A ISS
GO:0046658 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane
SoyBase N/A ISS
GO:0005507 GO-mf
Annotation by Michelle Graham. GO Molecular Function: copper ion binding
SoyBase N/A ISS
GO:0009055 GO-mf
Annotation by Michelle Graham. GO Molecular Function: electron carrier activity
SoyBase N/A ISS
PF02298 PFAM
Plastocyanin-like domain
JGI ISS
UniRef100_C6SVL3 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SVL3_SOYBN
SoyBase E_val: 6.00E-127 ISS
UniRef100_G7J9U0 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Early nodulin-like protein n=1 Tax=Medicago truncatula RepID=G7J9U0_MEDTR
SoyBase E_val: 3.00E-81 ISS
Expression Patterns of Glyma04g06410
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma04g06410
Paralog Evidence Comments
Glyma06g06450 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g06410 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g060600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g06410
Coding sequences of Glyma04g06410
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g06410.2 sequence type=CDS gene model=Glyma04g06410 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
TTTCTCCCCTGTTCTTCATCACACCATAAATGCAACACTCCAAACACCCCCACTAATGCAAACCCACCACTTTGTGCTTGTGTGTGCAAGAAAGGTAAAAGCTTTCACACACCCTTTTCACTTCTCAAAAAACAAAAGGCCATGGCTGGTTCCTCTGCTTCTCTTTTGTTCCTTTTCCTTCTCTTTGGATTCTCAGCAGCTAAGGAGCTATTGGTTGGAGGCAAAATAGATGCTTGGAAGATTCCATCTTCTGAATCAGATACCCTCAATCAATGGGCTGAAAGGTCTCGTTTCAGAGTGGGCGATCATCTAGTGTGGAAATATGAGAGTGGGAAGGACTCAGTGTTGGAAGTAACAAGGGAAGATTATGCTAATTGCAGCACATCCAACCCCATCAAAGAGTACAATGATGGAAACACTAAGGTGAAGCTTGAACATCCTGGTCCATTTTACTTCATCAGTGGATCAAAGGGGCACTGTGAGAAGGGGCAAAAGTTGATTGTGGTGGTAATGTCTCCAAGGCACACATTCACTGCCATTATTTCTCCAGCACCAACACCTTCTCCAGCAGAGTTCGAGGGTCCCGCTGTTGCTCCTACTAGCAGTGCCACAACGTTTCAAGTTGGCCTTCTCACTGCTCTTGGAGTTTTGGCTATTTATGTGGGTTTTCTCATGTAA
Predicted protein sequences of Glyma04g06410
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g06410.2 sequence type=predicted peptide gene model=Glyma04g06410 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
FLPCSSSHHKCNTPNTPTNANPPLCACVCKKGKSFHTPFSLLKKQKAMAGSSASLLFLFLLFGFSAAKELLVGGKIDAWKIPSSESDTLNQWAERSRFRVGDHLVWKYESGKDSVLEVTREDYANCSTSNPIKEYNDGNTKVKLEHPGPFYFISGSKGHCEKGQKLIVVVMSPRHTFTAIISPAPTPSPAEFEGPAVAPTSSATTFQVGLLTALGVLAIYVGFLM*