SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g06340

Feature Type:gene_model
Chromosome:Gm04
Start:4857899
stop:4858592
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g06340
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G24940AT Annotation by Michelle Graham. TAIR10: membrane-associated progesterone binding protein 2 | chr2:10609447-10609749 FORWARD LENGTH=100 SoyBaseE_val: 2.00E-55ISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0020037GO-mf Annotation by Michelle Graham. GO Molecular Function: heme binding SoyBaseN/AISS
PTHR10281Panther MEMBRANE ASSOCIATED PROGESTERONE RECEPTOR-RELATED JGI ISS
PF00173PFAM Cytochrome b5-like Heme/Steroid binding domain JGI ISS
UniRef100_D7LJH3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Membrane-associated progesterone binding protein 2 n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LJH3_ARALL SoyBaseE_val: 3.00E-53ISS
UniRef100_I1JU53UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JU53_SOYBN SoyBaseE_val: 2.00E-66ISS

Expression Patterns of Glyma04g06340
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g06340
ParalogEvidenceComments
Glyma06g06390 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g06340 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g060000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g06340
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g06340
>Glyma04g06340.1   sequence type=CDS   gene model=Glyma04g06340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGCTGACACCCCAGCAGCTGAGCCAATACAACGGCACGGACCCATCGAAGCCGATCTACGTGGCGGTGAAGGGCCGCGTCTACGACGTCACCACCGGAAAATCCTTTTACGGCCCCGGCGGCCCCTACGCCATGTTCGCCGGCAAAGACGCCAGCAGAGCCCTGGCGAAGATGAGCAAGAACGACGACGACATCTCCCCCTCCCTCGACGGCCTCTCCGACAAGGAGATCGGCGTTCTCAACGACTGGGAGAACAAATTCCAAGCTAAGTACCCTGTCGTTGCTCGTGTTCTCAATTAA
Predicted protein sequences of Glyma04g06340
>Glyma04g06340.1   sequence type=predicted peptide   gene model=Glyma04g06340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MELTPQQLSQYNGTDPSKPIYVAVKGRVYDVTTGKSFYGPGGPYAMFAGKDASRALAKMSKNDDDISPSLDGLSDKEIGVLNDWENKFQAKYPVVARVLN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo