Report for Sequence Feature Glyma04g06330
Feature Type: gene_model
Chromosome: Gm04
Start: 4846620
stop: 4848929
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g06330
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G24860 AT
Annotation by Michelle Graham. TAIR10: DnaJ/Hsp40 cysteine-rich domain superfamily protein | chr2:10587118-10588240 REVERSE LENGTH=144
SoyBase E_val: 2.00E-48 ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0031072 GO-mf
Annotation by Michelle Graham. GO Molecular Function: heat shock protein binding
SoyBase N/A ISS
GO:0051082 GO-mf
Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding
SoyBase N/A ISS
UniRef100_G7J9S8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Tsi1-interacting protein TSIP1 n=1 Tax=Medicago truncatula RepID=G7J9S8_MEDTR
SoyBase E_val: 3.00E-50 ISS
UniRef100_I1JU52 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JU52_SOYBN
SoyBase E_val: 2.00E-96 ISS
Expression Patterns of Glyma04g06330
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma04g06330
Paralog Evidence Comments
Glyma06g06380 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g06330 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g059900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g06330
Coding sequences of Glyma04g06330
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g06330.1 sequence type=CDS gene model=Glyma04g06330 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAGTAGGTGTGTATCTTGTGCGCTGATTCCCAATAAGAATTTCTTGGTATCACCAATTCAAATCCCAATTCATAATGCAGTAAAGGTTAGGGGCAACAATAGAACTTGTGGCCTGCGCGTTCAGCTTTCTATGGTGGACTCTTCCTCCGCTGATTTCACCAGACGCATCGAACGAGCTTGGTTAATTTCTAAGCAACCAGGGCCAATCGTGTGTTCATCTTGCGACTCAAAAGGGCATATTGAATGTAAATGGTGTGCGGGTACTGGTTTTTTTATTCTTGGTGATAACATGCTTTGTGAAGTCCCATCAAGAAACACTACCTGCATTATTTGCACTGGAAAGGGATCAATGTGCTGTTCTGATTGTCAAGGAACAGGCTTTCGTGCAAAGTGGTTGGGAGAACCTCCTTCTTCCTAG
Predicted protein sequences of Glyma04g06330
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g06330.1 sequence type=predicted peptide gene model=Glyma04g06330 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSRCVSCALIPNKNFLVSPIQIPIHNAVKVRGNNRTCGLRVQLSMVDSSSADFTRRIERAWLISKQPGPIVCSSCDSKGHIECKWCAGTGFFILGDNMLCEVPSRNTTCIICTGKGSMCCSDCQGTGFRAKWLGEPPSS*