Glyma04g06273 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g06273

Feature Type:	gene_model
Chromosome:	Gm04
Start:	4804175
stop:	4804990
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g06273

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G10745	AT	Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G24980.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). \| chr5:3396553-3396795 FORWARD LENGTH=51	SoyBase	E_val: 6.00E-14	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_I1JU47	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JU47_SOYBN	SoyBase	E_val: 2.00E-28	ISS

Expression Patterns of Glyma04g06273

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g06273 not represented in the dataset	Glyma04g06273 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g06273

Paralog	Evidence	Comments
Glyma06g06331	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g06273 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma04g06273

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g06273

Limit To All Plant Sequences

>Glyma04g06273.1   sequence type=CDS   gene model=Glyma04g06273   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGCGCGAACAACACACGCCGACGCGACCGTGGATCCAGGATGCAGTGCCTTTGTTAGTGGTTCTTCTAATAGCAGCTCATGTCCTAGCTATGATATATTGGATTTATAGATTAGCCACCCAGAAACAGGTGCAGCATAGGAGAAAGACTCACTGA

Predicted protein sequences of Glyma04g06273

Limit To All Plant Sequences

>Glyma04g06273.1   sequence type=predicted peptide   gene model=Glyma04g06273   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAREQHTPTRPWIQDAVPLLVVLLIAAHVLAMIYWIYRLATQKQVQHRRKTH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain