SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g05990

Feature Type:gene_model
Chromosome:Gm04
Start:4571773
stop:4572707
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g05990
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G20650AT Annotation by Michelle Graham. TAIR10: copper transporter 5 | chr5:6985481-6985921 REVERSE LENGTH=146 SoyBaseE_val: 9.00E-45ISS
GO:0006825GO-bp Annotation by Michelle Graham. GO Biological Process: copper ion transport SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0015680GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular copper ion transport SoyBaseN/AISS
GO:0035434GO-bp Annotation by Michelle Graham. GO Biological Process: copper ion transmembrane transport SoyBaseN/AISS
GO:0005770GO-cc Annotation by Michelle Graham. GO Cellular Compartment: late endosome SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005375GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion transmembrane transporter activity SoyBaseN/AISS
GO:0015089GO-mf Annotation by Michelle Graham. GO Molecular Function: high affinity copper ion transmembrane transporter activity SoyBaseN/AISS
KOG3386 KOG Copper transporter JGI ISS
PTHR12483Panther SOLUTE CARRIER FAMILY 31 (COPPER TRANSPORTERS) JGI ISS
PTHR12483:SF1Panther gb def: f31e8.4.p [caenorhabditis elegans] JGI ISS
PF04145PFAM Ctr copper transporter family JGI ISS
UniRef100_G7J942UniRef Annotation by Michelle Graham. Most informative UniRef hit: Copper transporter n=1 Tax=Medicago truncatula RepID=G7J942_MEDTR SoyBaseE_val: 1.00E-77ISS
UniRef100_I1JU26UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JU26_SOYBN SoyBaseE_val: 7.00E-99ISS

Expression Patterns of Glyma04g05990
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g05990
ParalogEvidenceComments
Glyma06g06000 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g05990 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g057000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g05990
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g05990
>Glyma04g05990.1   sequence type=CDS   gene model=Glyma04g05990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGCACATGACCTTTTACTGGAGCAGGAAGGTGAATCTCCTAATAGATTCATGGAAGACCAACGATTGGACGGAGTATCTCATCACTCTGCTCGCATGCCTCGTCGTTGCCGCCTTCTACCAGTTCCTAGAGAATCGCCGCATCCGCCTCAAGCTCATCGGCGCCGGAAATCCCTTCCCGGCAGAGATCGAGGCCCCGCTTCTGCGACGGAAGCTTGCCGGAAACCGCGCCAAGGTGGGCGTGAAGGTAGCCGGAGCGTTTCTGTTCGGGCTGAGCTCGGCGATCGGGTACTTGCTGATGTTGTCGGTGATGTCCTTCAACGGTGGGGTGTTTGTGGCCGTCGTCGTGGGTCTTGCTGTTGGTTACTTCTTCTTCAGGAACGAGGGCGAAGATTCCCTTGTCGTTGATACTTCGTGTGCCTGTGCTTAA
Predicted protein sequences of Glyma04g05990
>Glyma04g05990.1   sequence type=predicted peptide   gene model=Glyma04g05990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMHMTFYWSRKVNLLIDSWKTNDWTEYLITLLACLVVAAFYQFLENRRIRLKLIGAGNPFPAEIEAPLLRRKLAGNRAKVGVKVAGAFLFGLSSAIGYLLMLSVMSFNGGVFVAVVVGLAVGYFFFRNEGEDSLVVDTSCACA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo