SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g05904

Feature Type:gene_model
Chromosome:Gm04
Start:4486238
stop:4490655
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g05904
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G21930AT Annotation by Michelle Graham. TAIR10: P-type ATPase of Arabidopsis 2 | chr5:7243129-7248721 FORWARD LENGTH=883 SoyBaseE_val: 2.00E-60ISS
GO:0006754GO-bp Annotation by Michelle Graham. GO Biological Process: ATP biosynthetic process SoyBaseN/AISS
GO:0006812GO-bp Annotation by Michelle Graham. GO Biological Process: cation transport SoyBaseN/AISS
GO:0006825GO-bp Annotation by Michelle Graham. GO Biological Process: copper ion transport SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009767GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport chain SoyBaseN/AISS
GO:0030001GO-bp Annotation by Michelle Graham. GO Biological Process: metal ion transport SoyBaseN/AISS
GO:0046034GO-bp Annotation by Michelle Graham. GO Biological Process: ATP metabolic process SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0005375GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion transmembrane transporter activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0015662GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism SoyBaseN/AISS
GO:0043682GO-mf Annotation by Michelle Graham. GO Molecular Function: copper-transporting ATPase activity SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
PTHR24093Panther FAMILY NOT NAMED JGI ISS
PTHR24093:SF26Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_A7ISW5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Copper P1B-ATPase n=1 Tax=Glycine max RepID=A7ISW5_SOYBN SoyBaseE_val: 1.00E-83ISS
UniRef100_I1JU16UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JU16_SOYBN SoyBaseE_val: 1.00E-88ISS

Expression Patterns of Glyma04g05904
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g05904 not represented in the dataset
Glyma04g05904 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g05904 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma04g05904
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g05904
>Glyma04g05904.1   sequence type=CDS   gene model=Glyma04g05904   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTAGGTGATGGGATAAATGATGCACCCTCTTTGGCTGTGGCTGATGTTGGGATTGCTCTGCAGAATGAAGCTCAAGATAATGCTGCTTCGGATGCAGCATCTATCATACTTCTGGGGAACAAAATTTCACAAGTTGTCGATGCGCTAGATCTAGCACAGGCAACAATGGGAAAAGTGTACCAAAATTTGTCTTGGGCAGTCGCATATAATGTCGTTGCCATTCCCATTGCTGCTGGTGTGTTACTTCCCCATTTTGACTTCGCCATGACACCATCACTTTCAGGAGGACTGATGGCTCTGAGCTCCATCTTCGTGGTTGGCAACTCACTGCTTCTACAGCTTCATGGGTCTCAAATCTCTAGAAAGGTTGGGCCAACTCTAGAAAGCATATCTTCCCATTCAAACACAGATATGCTTAATGTAAAATAA
Predicted protein sequences of Glyma04g05904
>Glyma04g05904.1   sequence type=predicted peptide   gene model=Glyma04g05904   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVGDGINDAPSLAVADVGIALQNEAQDNAASDAASIILLGNKISQVVDALDLAQATMGKVYQNLSWAVAYNVVAIPIAAGVLLPHFDFAMTPSLSGGLMALSSIFVVGNSLLLQLHGSQISRKVGPTLESISSHSNTDMLNVK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo