SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g05890

Feature Type:gene_model
Chromosome:Gm04
Start:4476314
stop:4478460
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g05890
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G21920AT Annotation by Michelle Graham. TAIR10: YGGT family protein | chr5:7241350-7242765 REVERSE LENGTH=251 SoyBaseE_val: 1.00E-70ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF02325PFAM YGGT family JGI ISS
UniRef100_F8WLD3UniRef Annotation by Michelle Graham. Most informative UniRef hit: YGGT family protein n=1 Tax=Citrus unshiu RepID=F8WLD3_CITUN SoyBaseE_val: 2.00E-80ISS
UniRef100_I1JU15UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JU15_SOYBN SoyBaseE_val: 4.00E-174ISS

Expression Patterns of Glyma04g05890
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g05890
ParalogEvidenceComments
Glyma06g05880 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g05890 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g056000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g05890
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g05890
>Glyma04g05890.1   sequence type=CDS   gene model=Glyma04g05890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGCGAACGCTAACGACTTGTCCACTGAGATAGATTGTACTAAGAAGGTTTCCAATTGTTGGGGAAATGGTCAAATACCCTTTGCACTTCCTTTTCTCACACTCCCCAATTCCAACTTCACCACTCTCCTCTCTTCACCACCTCAACTACTCCACACATCATTCACCACTGCCGCTGACAATTTTTTCAGATTTGTACACTCCCTCGCTTCTCAGAACCCCTTCCTCAACAAAGTTCTCTCTCTCCCCGCCGAATTTCACACCTTATGCGTGCAGATTCGGAAGCAAAGGAACGTGGGGTTGGTGTCTAGTCATAATTTCGCTGCCGTTTTGCCCGGGGGTTCGGTGGCAGGGCTAGTGGTGGCTAACGGGGTTCTCAATTTCTTGAACATTTACAACACTTTGCTCATTGTTAGGCTTGTTTTGACATGGTTTCCCAACACTCCTCCTTCCATTGTTAGCCCCCTCAGCACCATATGTGACCCATACCTGAACATATTCCGTGGACTTATTCCCCCTCTGGGAGGAACCCTGGATCTCTCTCCCATTCTAGCATTCTTGGTCCTAAATGCATTCACCAGCACTGCTGCTGCACTCCCTGCCGAGCTTCCAGTCACAGAACAATCAAAACAAGGTCTTGCAGCGCCATTGCCCTCTACTACTTCACAGAAGAAATGGATGAGACGGTTTCAAGGGAACAGGTCAAGGACATCTGGTGATGATGCTAAATAG
Predicted protein sequences of Glyma04g05890
>Glyma04g05890.1   sequence type=predicted peptide   gene model=Glyma04g05890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGANANDLSTEIDCTKKVSNCWGNGQIPFALPFLTLPNSNFTTLLSSPPQLLHTSFTTAADNFFRFVHSLASQNPFLNKVLSLPAEFHTLCVQIRKQRNVGLVSSHNFAAVLPGGSVAGLVVANGVLNFLNIYNTLLIVRLVLTWFPNTPPSIVSPLSTICDPYLNIFRGLIPPLGGTLDLSPILAFLVLNAFTSTAAALPAELPVTEQSKQGLAAPLPSTTSQKKWMRRFQGNRSRTSGDDAK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo