SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma04g05731

Feature Type:gene_model
Chromosome:Gm04
Start:4368714
stop:4368926
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G12020AT Annotation by Michelle Graham. TAIR10: 17.6 kDa class II heat shock protein | chr5:3882409-3882876 REVERSE LENGTH=155 SoyBaseE_val: 5.00E-20ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
UniRef100_B9RQT9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Heat-shock protein, putative n=1 Tax=Ricinus communis RepID=B9RQT9_RICCO SoyBaseE_val: 1.00E-21ISS
UniRef100_B9RQT9UniRef Annotation by Michelle Graham. Best UniRef hit: Heat-shock protein, putative n=1 Tax=Ricinus communis RepID=B9RQT9_RICCO SoyBaseE_val: 1.00E-21ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g05731 not represented in the dataset

Glyma04g05731 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g054500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g05731.1   sequence type=CDS   gene model=Glyma04g05731   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACATAAGGAACGTGGGTTTGGATTCGACAGTGTTGTCCATCCTTGAAGACATGCTGGATTTGGCAGAGGAACCGGAAAAGGAGAAGGGAAAGAGCAACCCGTCGAGGGCTTACGTACGAGACGCGAAAGCCATGGCGGCGGCGACGCCCGCTGACGTGGCGGAGTATCCGAACTGCTACGTGTTCGTGGTGGACATGCCGCAGAGATAA

>Glyma04g05731.1   sequence type=predicted peptide   gene model=Glyma04g05731   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDIRNVGLDSTVLSILEDMLDLAEEPEKEKGKSNPSRAYVRDAKAMAAATPADVAEYPNCYVFVVDMPQR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo