Glyma04g05731 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g05731

Feature Type:	gene_model
Chromosome:	Gm04
Start:	4368714
stop:	4368926
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g05731

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G12020	AT	Annotation by Michelle Graham. TAIR10: 17.6 kDa class II heat shock protein \| chr5:3882409-3882876 REVERSE LENGTH=155	SoyBase	E_val: 5.00E-20	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0009408	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to heat	SoyBase	N/A	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0034976	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress	SoyBase	N/A	ISS
GO:0042542	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
UniRef100_B9RQT9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Heat-shock protein, putative n=1 Tax=Ricinus communis RepID=B9RQT9_RICCO	SoyBase	E_val: 1.00E-21	ISS
UniRef100_B9RQT9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Heat-shock protein, putative n=1 Tax=Ricinus communis RepID=B9RQT9_RICCO	SoyBase	E_val: 1.00E-21	ISS

Expression Patterns of Glyma04g05731

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g05731 not represented in the dataset	Glyma04g05731 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g05731 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g054500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g05731

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g05731

Limit To All Plant Sequences

>Glyma04g05731.1   sequence type=CDS   gene model=Glyma04g05731   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACATAAGGAACGTGGGTTTGGATTCGACAGTGTTGTCCATCCTTGAAGACATGCTGGATTTGGCAGAGGAACCGGAAAAGGAGAAGGGAAAGAGCAACCCGTCGAGGGCTTACGTACGAGACGCGAAAGCCATGGCGGCGGCGACGCCCGCTGACGTGGCGGAGTATCCGAACTGCTACGTGTTCGTGGTGGACATGCCGCAGAGATAA

Predicted protein sequences of Glyma04g05731

Limit To All Plant Sequences

>Glyma04g05731.1   sequence type=predicted peptide   gene model=Glyma04g05731   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDIRNVGLDSTVLSILEDMLDLAEEPEKEKGKSNPSRAYVRDAKAMAAATPADVAEYPNCYVFVVDMPQR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain