|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G01800 | AT | Annotation by Michelle Graham. TAIR10: Albino or Glassy Yellow 1 | chr4:770926-776134 REVERSE LENGTH=1042 | SoyBase | E_val: 1.00E-45 | ISS |
| GO:0006605 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting | SoyBase | N/A | ISS |
| GO:0006886 | GO-bp | Annotation by Michelle Graham. GO Biological Process: intracellular protein transport | SoyBase | N/A | ISS |
| GO:0009646 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to absence of light | SoyBase | N/A | ISS |
| GO:0009658 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chloroplast organization | SoyBase | N/A | ISS |
| GO:0010027 | GO-bp | Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization | SoyBase | N/A | ISS |
| GO:0010090 | GO-bp | Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis | SoyBase | N/A | ISS |
| GO:0010109 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of photosynthesis | SoyBase | N/A | ISS |
| GO:0017038 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein import | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009570 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma | SoyBase | N/A | ISS |
| GO:0009941 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| PF07516 | PFAM | SecA Wing and Scaffold domain | JGI | ISS | |
| UniRef100_I1LAT5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Protein translocase subunit SecA 5 n=1 Tax=Glycine max RepID=I1LAT5_SOYBN | SoyBase | E_val: 9.00E-71 | ISS |
| UniRef100_UPI000233C640 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233C640 related cluster n=1 Tax=unknown RepID=UPI000233C640 | SoyBase | E_val: 9.00E-71 | ISS |
|
Glyma04g05641 not represented in the dataset |
Glyma04g05641 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.04g053600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma04g05641.1 sequence type=CDS gene model=Glyma04g05641 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAAGAGGCAGAGCGGTTCCTAATCTTAAGCAATATCGATCGCCTGTGGAAAGAACATCTGCAGGCACTAAAATTTGTTCAGCAAGCCGTGGGGTTACGGGGATATGCGCAGCGGGATCCTCTTATTGAGTATAAGGTTGAAGGCTATAACCTTTTCTTGGATATGATGGCACAAATAAGAAGAAATGTCATGCATTCTGTGTATCAGTTTGAACCTGTGCTGGTAGAGCAAGATCAGGACAAAACAGAGAATCGGAAATCAGGAAAACGTAATGCACGCACTCAGGTTAATCCAAACCCTGATCCAGTTGGCACTGTCGAGCCTTCAACGTCAAGTACTACTTCCTAA
>Glyma04g05641.1 sequence type=predicted peptide gene model=Glyma04g05641 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKEAERFLILSNIDRLWKEHLQALKFVQQAVGLRGYAQRDPLIEYKVEGYNLFLDMMAQIRRNVMHSVYQFEPVLVEQDQDKTENRKSGKRNARTQVNPNPDPVGTVEPSTSSTTS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||