SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g05641

Feature Type:gene_model
Chromosome:Gm04
Start:4304995
stop:4305768
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g05641
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G01800AT Annotation by Michelle Graham. TAIR10: Albino or Glassy Yellow 1 | chr4:770926-776134 REVERSE LENGTH=1042 SoyBaseE_val: 1.00E-45ISS
GO:0006605GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting SoyBaseN/AISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0009646GO-bp Annotation by Michelle Graham. GO Biological Process: response to absence of light SoyBaseN/AISS
GO:0009658GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast organization SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010090GO-bp Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis SoyBaseN/AISS
GO:0010109GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of photosynthesis SoyBaseN/AISS
GO:0017038GO-bp Annotation by Michelle Graham. GO Biological Process: protein import SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
PF07516PFAM SecA Wing and Scaffold domain JGI ISS
UniRef100_I1LAT5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein translocase subunit SecA 5 n=1 Tax=Glycine max RepID=I1LAT5_SOYBN SoyBaseE_val: 9.00E-71ISS
UniRef100_UPI000233C640UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C640 related cluster n=1 Tax=unknown RepID=UPI000233C640 SoyBaseE_val: 9.00E-71ISS

Expression Patterns of Glyma04g05641
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g05641 not represented in the dataset
Glyma04g05641 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g05641 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g053600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g05641
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g05641
>Glyma04g05641.1   sequence type=CDS   gene model=Glyma04g05641   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAGAGGCAGAGCGGTTCCTAATCTTAAGCAATATCGATCGCCTGTGGAAAGAACATCTGCAGGCACTAAAATTTGTTCAGCAAGCCGTGGGGTTACGGGGATATGCGCAGCGGGATCCTCTTATTGAGTATAAGGTTGAAGGCTATAACCTTTTCTTGGATATGATGGCACAAATAAGAAGAAATGTCATGCATTCTGTGTATCAGTTTGAACCTGTGCTGGTAGAGCAAGATCAGGACAAAACAGAGAATCGGAAATCAGGAAAACGTAATGCACGCACTCAGGTTAATCCAAACCCTGATCCAGTTGGCACTGTCGAGCCTTCAACGTCAAGTACTACTTCCTAA
Predicted protein sequences of Glyma04g05641
>Glyma04g05641.1   sequence type=predicted peptide   gene model=Glyma04g05641   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKEAERFLILSNIDRLWKEHLQALKFVQQAVGLRGYAQRDPLIEYKVEGYNLFLDMMAQIRRNVMHSVYQFEPVLVEQDQDKTENRKSGKRNARTQVNPNPDPVGTVEPSTSSTTS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo