SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g05580

Feature Type:gene_model
Chromosome:Gm04
Start:4233584
stop:4236829
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g05580
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G13920AT Annotation by Michelle Graham. TAIR10: eukaryotic translation initiation factor 4A1 | chr3:4592635-4594128 REVERSE LENGTH=412 SoyBaseE_val: 0ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006413GO-bp Annotation by Michelle Graham. GO Biological Process: translational initiation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003743GO-mf Annotation by Michelle Graham. GO Molecular Function: translation initiation factor activity SoyBaseN/AISS
GO:0004386GO-mf Annotation by Michelle Graham. GO Molecular Function: helicase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0008026GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP-dependent helicase activity SoyBaseN/AISS
KOG0328 KOG Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily JGI ISS
PTHR24031Panther FAMILY NOT NAMED JGI ISS
PTHR24031:SF2Panther SUBFAMILY NOT NAMED JGI ISS
PF00270PFAM DEAD/DEAH box helicase JGI ISS
PF00271PFAM Helicase conserved C-terminal domain JGI ISS
UniRef100_Q40465UniRef Annotation by Michelle Graham. Most informative UniRef hit: Eukaryotic initiation factor 4A-11 n=1 Tax=Nicotiana tabacum RepID=IF411_TOBAC SoyBaseE_val: 0ISS
UniRef100_UPI0001B63A7AUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0001B63A7A related cluster n=1 Tax=unknown RepID=UPI0001B63A7A SoyBaseE_val: 0ISS

Expression Patterns of Glyma04g05580
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g05580
ParalogEvidenceComments
Glyma06g05580 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g05580 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g052900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g05580
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g05580
>Glyma04g05580.1   sequence type=CDS   gene model=Glyma04g05580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGGGTTGGCGCCAGAAGGATCACAATTTGATGCTCGTCAATATGATGCTAAGATGAATGAGTTACTTGGAACTGATGGGCAAGATTTTTTTACTTCTTATGACGAAGTTTGTGAAAGCTTTGATGCTATGGGATTGCAGGAGAACCTTCTGAGGGGTATTTATGCATATGGTTTTGAGAAGCCCTCTGCAATTCAACAAAGGGGGATTGTTCCTTTCTGCAAGGGGCTTGATGTTATTCAGCAAGCACAATCTGGAACTGGAAAAACTGCTACCTTTTGTTCTGGAGTTTTGCAGCAGCTTGATTACAGCTTAGTAGAATGCCAGGCACTGGTTCTTGCTCCCACTCGTGAACTTGCACAACAAATTGAAAAGGTCATGCGAGCACTAGGGGACTATCTTGGTGTCAAGGTTCATGCTTGTGTTGGTGGGACCAGTGTTCGTGAAGATCAACGCATCCTCTCAAGTGGGGTTCATGTTGTTGTTGGTACTCCTGGACGTGTATTTGACATGCTGCGCAGGCAATCATTGCGCTCTGATAACATCAGGATGTTTGTATTGGATGAGGCAGATGAGATGCTCTCTCGAGGTTTCAAGGATCAGATCTATGATATTTTTCAGCTGCTGCCACCTAAGATCCAGGTTGGGGTTTTCTCTGCCACAATGCCTCCTGAAGCCCTGGAAATCACAAGGAAGTTTATGAACAAACCTGTGAGGATTCTAGTAAAACGTGATGAGCTTACCTTGGAGGGGATCAAGCAATTTTTTGTCAATGTAGACAAGGAGGACTGGAAGCTCGAGACACTATGTGATCTTTATGAAACTTTGGCAATCACCCAGAGTGTTATCTTTGTGAACACCAGACGCAAGGTAGATTGGCTGACAGACAAAATGCGGAGTCGTGATCACACAGTTTCAGCCACTCATGGAGATATGGACCAAAACACAAGGGATATCATCATGCGGGAATTCCGTTCTGGGTCCTCCCGTGTTCTTATTACCACAGATCTTTTGGCCCGTGGTATTGATGTCCAACAAGTCTCACTTGTTATAAATTATGATCTGCCAACTCAGCCAGAGAACTATCTCCATCGAATTGGTCGTAGTGGACGGTTTGGGAGAAAGGGTGTTGCTATCAATTTTGTGACTGGGGATGATGAAAGGATGCTGTTTGACATCCAAAAGTTTTATAATGTGCAGATTGAGGAGCTGCCAGCCAATGTAGCCGATCTCATTTGA
Predicted protein sequences of Glyma04g05580
>Glyma04g05580.1   sequence type=predicted peptide   gene model=Glyma04g05580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAGLAPEGSQFDARQYDAKMNELLGTDGQDFFTSYDEVCESFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRSDNIRMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFFVNVDKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTGDDERMLFDIQKFYNVQIEELPANVADLI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo