Report for Sequence Feature Glyma04g05570
Feature Type: gene_model
Chromosome: Gm04
Start: 4227958
stop: 4229832
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g05570
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G11970 AT
Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF3511) | chr5:3863289-3863606 REVERSE LENGTH=105
SoyBase E_val: 2.00E-31 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF12023 PFAM
Domain of unknown function (DUF3511)
JGI ISS
UniRef100_I1JTY4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JTY4_SOYBN
SoyBase E_val: 3.00E-77 ISS
Expression Patterns of Glyma04g05570
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma04g05570 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g052800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g05570
Coding sequences of Glyma04g05570
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g05570.1 sequence type=CDS gene model=Glyma04g05570 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAGGAGTTTCAAAGATCAAGGTCTTATGCAAATGGGCAAATGATGCAGATAGAGAGCTACTATGGAGCTCCTAGGCCTTATGATCTTAGTCTCAGAACTTATAGTGCTTCTTATGCACAAACTCAAATAGGTCCTCCTAGGGACTTGAAGTTGAAGAAAGGAAAAAGCATTTCTGCAGGGTCTTCTTTCTCCAAGTCTTGGAGCTTTGCTGATCCTGAGCTTCAGAGGAAGAAGAGGGTTGCTAGCTATAAAATGTATTCTGTGGAAGGAAAGATCAAAGGGTCCTTCAGGAAGAGCTTCAGGTGGCTGAAGAACAAGTACTCCCATGTGGTTTATGGTTGGTAG
Predicted protein sequences of Glyma04g05570
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g05570.1 sequence type=predicted peptide gene model=Glyma04g05570 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEEFQRSRSYANGQMMQIESYYGAPRPYDLSLRTYSASYAQTQIGPPRDLKLKKGKSISAGSSFSKSWSFADPELQRKKRVASYKMYSVEGKIKGSFRKSFRWLKNKYSHVVYGW*