SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g05431): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g05431): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g05431

Feature Type:gene_model
Chromosome:Gm04
Start:4112757
stop:4114427
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G26150AT Annotation by Michelle Graham. TAIR10: cytokinin-responsive gata factor 1 | chr4:13253210-13254659 FORWARD LENGTH=352 SoyBaseE_val: 2.00E-22ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0007623GO-bp Annotation by Michelle Graham. GO Biological Process: circadian rhythm SoyBaseN/AISS
GO:0009416GO-bp Annotation by Michelle Graham. GO Biological Process: response to light stimulus SoyBaseN/AISS
GO:0009735GO-bp Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus SoyBaseN/AISS
GO:0009740GO-bp Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway SoyBaseN/AISS
GO:0009910GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of flower development SoyBaseN/AISS
GO:0010187GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of seed germination SoyBaseN/AISS
GO:0010380GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of chlorophyll biosynthetic process SoyBaseN/AISS
GO:0010468GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of gene expression SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
GO:0044212GO-mf Annotation by Michelle Graham. GO Molecular Function: transcription regulatory region DNA binding SoyBaseN/AISS
PTHR10071Panther TRANSCRIPTION FACTOR GATA (GATA BINDING FACTOR) JGI ISS
PF00320PFAM GATA zinc finger JGI ISS
UniRef100_G7I9Y4UniRef Annotation by Michelle Graham. Most informative UniRef hit: GATA transcription factor n=1 Tax=Medicago truncatula RepID=G7I9Y4_MEDTR SoyBaseE_val: 6.00E-37ISS
UniRef100_I1JTW9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JTW9_SOYBN SoyBaseE_val: 5.00E-94ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g05431 not represented in the dataset

Glyma04g05431 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g051300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g05431.1   sequence type=CDS   gene model=Glyma04g05431   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTTCTGTTTCACTGAACCCCAACCCCCCATGCCCTACGATACAAGATCAAAGTCAACTCTTCATTTCTGCGAATAATCACGAATCAACTTCTCTCTCATGTTGCACCTTCTTTCACATACTCGATCAAAGCCAAACCAAAGATATCAGAGATTTAAGACATGGTCATCAACAGGATGGGAAGCTTGTATTTCATATTGGACCATCAAACAACAACAACCAAGTGTGCAATTCATCCTCCGTTAAACTTCAACCTAAGCCCGTTAAGGCAGATTCAAGCAGCGAGTGTGGCCACCATAACGTTTCCTTGTACAAAATAGAGGACGAAGAGAACAAAAGAGATCATGATTATGAAAAATGGATGTCTTCAACTGCGAGGTTAACGAGAAAAATGATGAGGCTACCTAGCACTAGCAGCGATCTGGCCACAAAGAAAGCATTGAATAATATTACAAGGGTTTGTGCGGATTGCAACACAACCAGTACCCCACTCTGGAGGAGTGGTCCTAATGGTCCTAAGTCACTTTGCAATGCCTGCGGCATTCGACAGAGGAAGGCAAGAAGGGCAATGGCAGAAGCTGTAAATGGTTTTGCTCCTTCCGTGAATTCATCTTCTACAAAGATCAGAGTGCATCACAAGGAAAAGAAGTCTCGTACAAACCATTTTGCACGGTTCAGGCTTAAGTGCAAGTTGGCAACTACTAGTACTGCTGAAGGAACATCTCAGCAGGAGAACGTGAAGATTGATTTGAACGATTTTGGTTTGAGTTTGAGGGATAGTTCGGCTTTGAAGCAGCAAGTGTTTCCAATAATGGATGAAGTAGCTCAGGCAGCGATGCTTCTCATGGATTTATCTTGCGGCTTTGTTTACTGTTAA

>Glyma04g05431.1   sequence type=predicted peptide   gene model=Glyma04g05431   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTSVSLNPNPPCPTIQDQSQLFISANNHESTSLSCCTFFHILDQSQTKDIRDLRHGHQQDGKLVFHIGPSNNNNQVCNSSSVKLQPKPVKADSSSECGHHNVSLYKIEDEENKRDHDYEKWMSSTARLTRKMMRLPSTSSDLATKKALNNITRVCADCNTTSTPLWRSGPNGPKSLCNACGIRQRKARRAMAEAVNGFAPSVNSSSTKIRVHHKEKKSRTNHFARFRLKCKLATTSTAEGTSQQENVKIDLNDFGLSLRDSSALKQQVFPIMDEVAQAAMLLMDLSCGFVYC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo