SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g05340): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g05340): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g05340

Feature Type:gene_model
Chromosome:Gm04
Start:4062120
stop:4065101
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G11770AT Annotation by Michelle Graham. TAIR10: NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial | chr5:3791148-3792929 REVERSE LENGTH=218 SoyBaseE_val: 1.00E-122ISS
GO:0006120GO-bp Annotation by Michelle Graham. GO Biological Process: mitochondrial electron transport, NADH to ubiquinone SoyBaseN/AISS
GO:0006486GO-bp Annotation by Michelle Graham. GO Biological Process: protein glycosylation SoyBaseN/AISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005747GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex I SoyBaseN/AISS
GO:0008137GO-mf Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase (ubiquinone) activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0016651GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on NAD(P)H SoyBaseN/AISS
GO:0048038GO-mf Annotation by Michelle Graham. GO Molecular Function: quinone binding SoyBaseN/AISS
GO:0051539GO-mf Annotation by Michelle Graham. GO Molecular Function: 4 iron, 4 sulfur cluster binding SoyBaseN/AISS
KOG1687 KOG NADH-ubiquinone oxidoreductase, NUFS7/PSST/20 kDa subunit JGI ISS
PTHR11995Panther NADH DEHYDROGENASE JGI ISS
PF01058PFAM NADH ubiquinone oxidoreductase, 20 Kd subunit JGI ISS
UniRef100_B9RRU5UniRef Annotation by Michelle Graham. Most informative UniRef hit: NADH-plastoquinone oxidoreductase, putative n=1 Tax=Ricinus communis RepID=B9RRU5_RICCO SoyBaseE_val: 2.00E-129ISS
UniRef100_I1JTW0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JTW0_SOYBN SoyBaseE_val: 2.00E-155ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g05340 not represented in the dataset

Glyma04g05340 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g05410 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g050600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g05340.1   sequence type=CDS   gene model=Glyma04g05340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCTTCTGAGTCGAGCCTCTTCACGCTTCCCTCAGCTGGTTTCCCCTCAAAGAGTTGTTTCCCTCCACACAACGCTCCCATCTCTTAACGCATCAACATCCACACCCACGCCCGCCCCATATGCCCCGCCACCGCCTCCGTCCGCTTCCCCTCCCGCCGGCGTGTCGAAGGCGGCGGAGTTCGTGATCTCGAAGGTTGACGATCTGATGAACTGGGCCCGGCGCGGCTCCATCTGGCCCATGACCTTCGGCCTCGCCTGCTGCGCCGTCGAAATGATGCACACCGGCGCCGCCCGCTACGATCTCGACCGCTTCGGCATCATTTTCAGGCCCAGCCCTCGCCAGTCTGATTGCATGATCGTCGCTGGCACTCTCACCAACAAGATGGCTCCCGCTCTTCGCAAGGTTTATGACCAAATGCCTGAGCCTAGATGGGTTGTCTCAATGGGAAGTTGTGCTAATGGAGGAGGATACTACCATTACTCTTACTCCGTAGTTCGGGGATGTGACAGGATTGTTCCTGTTGACATATATATTCCAGGCTGTCCTCCAACTGCTGAGGCTTTGCTGTATGGACTCCTCCAGCTGCAGAAAAAGATCAATAGGCGCAAAGACTTCCTCCATTGGTGGACAAAGTGA

>Glyma04g05340.1   sequence type=predicted peptide   gene model=Glyma04g05340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALLSRASSRFPQLVSPQRVVSLHTTLPSLNASTSTPTPAPYAPPPPPSASPPAGVSKAAEFVISKVDDLMNWARRGSIWPMTFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDCMIVAGTLTNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGLLQLQKKINRRKDFLHWWTK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo