SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g05230): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g05230): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g05230

Feature Type:gene_model
Chromosome:Gm04
Start:3990025
stop:3990956
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g05230
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G26010AT Annotation by Michelle Graham. TAIR10: Protein phosphatase 2C family protein | chr5:9085512-9087372 REVERSE LENGTH=331 SoyBaseE_val: 1.00E-19ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0006826GO-bp Annotation by Michelle Graham. GO Biological Process: iron ion transport SoyBaseN/AISS
GO:0010106GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion starvation SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004722GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine phosphatase activity SoyBaseN/AISS
PTHR13832Panther PROTEIN PHOSPHATASE 2C JGI ISS
PTHR13832:SF94Panther PROTEIN PHOSPHATASE 2C DELTA JGI ISS
PF00481PFAM Protein phosphatase 2C JGI ISS
UniRef100_B9RRV1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein phosphatase-2c, putative n=1 Tax=Ricinus communis RepID=B9RRV1_RICCO SoyBaseE_val: 2.00E-28ISS
UniRef100_I1JTU7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JTU7_SOYBN SoyBaseE_val: 8.00E-157ISS

Expression Patterns of Glyma04g05230
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g05230 not represented in the dataset
Glyma04g05230 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g05230 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma04g05230
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g05230
>Glyma04g05230.1   sequence type=CDS   gene model=Glyma04g05230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTTGAAGCAACAACCAAGGTTCTAAGTGGACTTTGCTCTGCTTACACTAAACAAGGTAGCAAAGGACTTAACCAATTGCTCCTTTACAAGGGTTATGGAACGGAAAACGCGGCATTTTGTGGCGTATTTGATGGGCATGGAAAGAATGGTCACGTAGTAAGCAAAATAGTAAACAGCCGTTTGTCATCATCACTCATACGGAGCCAAAAGAAACTCCAAACAAGAATTCTCACGAATGGGAAAGAGGCTATTCTTGATGCTTTCAGAGTGATGAACAAGGAGATCAAGCTACAAGAGAATCTAGACTGCTCTTGCAGTGGAACTACTGCTGTATTTGCGCTGAAGGAAGAACCACGCATCCAGCGAGTGTGGTTACCCAATGAGACCAGATATTTATTGTATTTGCAAGTGTGGGATGTACTAAGCAACAAGGAGGTTTGCTCAATTGTGTGGGGGCAGAAACTGAGAAAGAAGCAGCATGGAAACACAAGTATCCTTCTTCTAAGGTTGATGACTGCACTGTGGTTTGCCTCTTCCTCCACAAGAAACCACAGTTTCTTGATACAAGTTATAGAAACTAGAAAGTTGATAAGAGGATGTATTGCATCTGTTTTTCTAGTAGTTTCTCTCTTTTACTTTATAAATATCCAT
Predicted protein sequences of Glyma04g05230
>Glyma04g05230.1   sequence type=predicted peptide   gene model=Glyma04g05230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
FEATTKVLSGLCSAYTKQGSKGLNQLLLYKGYGTENAAFCGVFDGHGKNGHVVSKIVNSRLSSSLIRSQKKLQTRILTNGKEAILDAFRVMNKEIKLQENLDCSCSGTTAVFALKEEPRIQRVWLPNETRYLLYLQVWDVLSNKEVCSIVWGQKLRKKQHGNTSILLLRLMTALWFASSSTRNHSFLIQVIETRKLIRGCIASVFLVVSLFYFINIH






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo