Report for Sequence Feature Glyma04g04910
Feature Type: gene_model
Chromosome: Gm04
Start: 3662439
stop: 3664050
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g04910
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G33800 AT
Annotation by Michelle Graham. TAIR10: unknown protein; Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr4:16210404-16211307 REVERSE LENGTH=170
SoyBase E_val: 3.00E-12 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1JTR7 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JTR7_SOYBN
SoyBase E_val: 9.00E-133 ISS
Expression Patterns of Glyma04g04910
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma04g04910
Paralog Evidence Comments
Glyma06g05010 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g04910 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g046600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g04910
Coding sequences of Glyma04g04910
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g04910.1 sequence type=CDS gene model=Glyma04g04910 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGATATATCAAGTTCACAATACAATAGTGCTGGTGAATCTGGCTGGACACATTACTTGGATCATTCCTCTCTTTCTGAAAGTTATTTCCAGATGAGAGGTGGGATAGAAGACCATGGAGGAAAGGGAGCAAGAGTGGAGGAAGAGGAAGAAGATTTGTCTATGATCTCTGATGCTTCATCTGGTCCTCAACATTACCATGAAGATGATGGTCAACACTACTGTGTAAATTGGTATCCTTCTACTTCTCACTACACCAAAGAATCAGAAAAGAAGAAGAACAACAACAAGAAGGCCAAAGAATATGGTAACAATCAACATCCTTCACCTCTTGATGACACTGCCAGTTCCCCTGTTCTTAACTGTCCCAAGAAGAAAGCCAGTTTCTCAGGGAATGGAGCAGTGGAAAATGCACTAGATTTTCCCCCATGTTTCTCGGGAACAAAAATAAAGAAAAAGTCTAAATTCCAGAAGCACTTCAGTTTCTTTGAGCGTTCTCTTGGTGGAAAACAAGCTTCAGAGGAACCAGGTGGTTTCGATGAAGGATGGAAATGA
Predicted protein sequences of Glyma04g04910
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g04910.1 sequence type=predicted peptide gene model=Glyma04g04910 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MDISSSQYNSAGESGWTHYLDHSSLSESYFQMRGGIEDHGGKGARVEEEEEDLSMISDASSGPQHYHEDDGQHYCVNWYPSTSHYTKESEKKKNNNKKAKEYGNNQHPSPLDDTASSPVLNCPKKKASFSGNGAVENALDFPPCFSGTKIKKKSKFQKHFSFFERSLGGKQASEEPGGFDEGWK*