SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g04580

Feature Type:gene_model
Chromosome:Gm04
Start:3418806
stop:3420827
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g04580
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G47200AT Annotation by Michelle Graham. TAIR10: WPP domain protein 2 | chr1:17298181-17298723 REVERSE LENGTH=180 SoyBaseE_val: 1.00E-41ISS
GO:0006913GO-bp Annotation by Michelle Graham. GO Biological Process: nucleocytoplasmic transport SoyBaseN/AISS
GO:0048527GO-bp Annotation by Michelle Graham. GO Biological Process: lateral root development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005640GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nuclear outer membrane SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_Q2HRI7UniRef Annotation by Michelle Graham. Most informative UniRef hit: MFP1 attachment factor n=1 Tax=Medicago truncatula RepID=Q2HRI7_MEDTR SoyBaseE_val: 6.00E-44ISS
UniRef100_UPI000189D5D4UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000189D5D4 related cluster n=1 Tax=unknown RepID=UPI000189D5D4 SoyBaseE_val: 1.00E-106ISS

Expression Patterns of Glyma04g04580
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g04580
ParalogEvidenceComments
Glyma06g04660 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g04580 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g043200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g04580
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g04580
>Glyma04g04580.1   sequence type=CDS   gene model=Glyma04g04580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCGACCCGGAAAACACACCCGCGCCCCAATCGGAGCAAGACTCCTCTTCGCCACCGCCCGCCCAAGACCAACCCGTCGCCGCTGACGCCAAGCTCGGCCCCGCCGGCGTCTCCTTCAGCATATGGCCCCCCACTCAGCGCACGCGCGACGCCGTCATCACTCGCCTCATCGAAACCCTATCCTCCCCCTCCGTCCTCTCCAAACGTTACGGGACAATGTCCCCCGACGAGGCCTCCACTGCCGCCCGCCAGATCGAGGACCAGGCCTTTTCCGTCGCCGCCAGCTCCGCCGCCTCCGACAACGACGGGATCGAGATCCTCCAGGTCTATTCCAAGGAGATTAGCAAACGGATGCTCGACACCGTCAAGGCCAAATCCACCACCGCTTCCGCCGCCGTCGATATCGGGACTCCTGCCTCCGATGCTGCTCCTGCCCCCGCCGCAGATGGCGACTCCGCCGCTGGCGCCGAGTCCGAAACCTGA
Predicted protein sequences of Glyma04g04580
>Glyma04g04580.1   sequence type=predicted peptide   gene model=Glyma04g04580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSDPENTPAPQSEQDSSSPPPAQDQPVAADAKLGPAGVSFSIWPPTQRTRDAVITRLIETLSSPSVLSKRYGTMSPDEASTAARQIEDQAFSVAASSAASDNDGIEILQVYSKEISKRMLDTVKAKSTTASAAVDIGTPASDAAPAPAADGDSAAGAESET*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo