SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma04g04540

Feature Type:gene_model
Chromosome:Gm04
Start:3395831
stop:3397238
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G24210AT Annotation by Michelle Graham. TAIR10: F-box family protein | chr4:12563658-12564113 FORWARD LENGTH=151 SoyBaseE_val: 2.00E-56ISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009740GO-bp Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0009939GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of gibberellic acid mediated signaling pathway SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0010325GO-bp Annotation by Michelle Graham. GO Biological Process: raffinose family oligosaccharide biosynthetic process SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0048444GO-bp Annotation by Michelle Graham. GO Biological Process: floral organ morphogenesis SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0019005GO-cc Annotation by Michelle Graham. GO Cellular Compartment: SCF ubiquitin ligase complex SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
UniRef100_C4T9C1UniRef Annotation by Michelle Graham. Most informative UniRef hit: SLEEPY1a n=1 Tax=Lotus japonicus RepID=C4T9C1_LOTJA SoyBaseE_val: 7.00E-75ISS
UniRef100_I1JTN4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JTN4_SOYBN SoyBaseE_val: 8.00E-133ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g04640 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g042900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g04540.2   sequence type=CDS   gene model=Glyma04g04540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGCGTCCACTGTCACCATCAGCGAGCGGCGTGAACGTTGAGGACAGGAAGATGAAGAAGAAGGCGAAGGCGGTGGAAAATGAGGACGATAACGGGGAGCGCGTGGAGGGGCTGGCGCATTTCGACGACAACCTTCTGTTCGAGGTCTTGAAACACGTGGACGCGCGGACCCTGGCGATGTCGGGGTGCGTGAACAAGCAGTGGCACAAGACGGCGCAGGACGAGAGACTCTGGGAACTGATCTGCACAAAGCAGTGGGCAAACACTGGCTGCGGGGAGCAACAGCTAAGATCCGTGGTCCTCGCGCTCGGTGGCTTCCGTCGCCTCCACGCGCTTTACCTCTTCCCTCTCTCAAAGCCTCAACAAACACCATCTTCTTCATCTTCATCGACCTCGTCCTCTTCCTCCTCGGCCTGGGGCCCCACCATACCCCAGGTGATTCGATCGAAGCCGCTACGTTTGGGGAAAGACGAGGTTCACCTCTCTCTTTCGCTCCTCTCCATTCGCTACTACGAGAAGATGAATTTCAATAACAGAACCACCAGATGA

>Glyma04g04540.2   sequence type=predicted peptide   gene model=Glyma04g04540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKRPLSPSASGVNVEDRKMKKKAKAVENEDDNGERVEGLAHFDDNLLFEVLKHVDARTLAMSGCVNKQWHKTAQDERLWELICTKQWANTGCGEQQLRSVVLALGGFRRLHALYLFPLSKPQQTPSSSSSSTSSSSSSAWGPTIPQVIRSKPLRLGKDEVHLSLSLLSIRYYEKMNFNNRTTR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo