Glyma04g04110 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g04110): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g04110): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g04110

Feature Type:	gene_model
Chromosome:	Gm04
Start:	3019987
stop:	3021151
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g04110

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G45474	AT	Annotation by Michelle Graham. TAIR10: photosystem I light harvesting complex gene 5 \| chr1:17179353-17180439 FORWARD LENGTH=256	SoyBase	E_val: 1.00E-42	ISS
GO:0006364	GO-bp	Annotation by Michelle Graham. GO Biological Process: rRNA processing	SoyBase	N/A	ISS
GO:0009657	GO-bp	Annotation by Michelle Graham. GO Biological Process: plastid organization	SoyBase	N/A	ISS
GO:0009765	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis, light harvesting	SoyBase	N/A	ISS
GO:0009768	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis, light harvesting in photosystem I	SoyBase	N/A	ISS
GO:0010027	GO-bp	Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization	SoyBase	N/A	ISS
GO:0010207	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosystem II assembly	SoyBase	N/A	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009782	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: photosystem I antenna complex	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0030076	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: light-harvesting complex	SoyBase	N/A	ISS
GO:0031409	GO-mf	Annotation by Michelle Graham. GO Molecular Function: pigment binding	SoyBase	N/A	ISS
PTHR21649	Panther	CHLOROPHYLL A/B BINDING PROTEIN	JGI		ISS
PF00504	PFAM	Chlorophyll A-B binding protein	JGI		ISS
UniRef100_G7J6D2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Chlorophyll a-b binding protein n=1 Tax=Medicago truncatula RepID=G7J6D2_MEDTR	SoyBase	E_val: 3.00E-44	ISS
UniRef100_I1JTJ2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JTJ2_SOYBN	SoyBase	E_val: 1.00E-67	ISS

Expression Patterns of Glyma04g04110

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g04110 not represented in the dataset	Glyma04g04110 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g04110 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma04g04110

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g04110

Limit To All Plant Sequences

>Glyma04g04110.1   sequence type=CDS   gene model=Glyma04g04110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTGGGGTCTTCGGAATTCTGGTGACAGATCTACTTCGCGTCACAGGAATTAACAAGATACCAGTTTGGTTTGAAGCTGGTGCAGTAAAGTACGACTTTGCCAATACAAAGACACTCTTCCTTGTTCAACTACTTCTGATGGGGTTTGTGGAAACAAAAAGGTACATGGATTTTGTTAGTCCTGGATCTCAAGCTAAAGAGGGGTCTTTCTTTGGATTGGAAGCTTCACTGAAAGGCTTAGAGCCAGGGTATTTACATTTTCCAATAACAAAAAATATATATTTGTCTCTTATCTTTCTCCTTCAGTTTTGA

Predicted protein sequences of Glyma04g04110

Limit To All Plant Sequences

>Glyma04g04110.1   sequence type=predicted peptide   gene model=Glyma04g04110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLGVFGILVTDLLRVTGINKIPVWFEAGAVKYDFANTKTLFLVQLLLMGFVETKRYMDFVSPGSQAKEGSFFGLEASLKGLEPGYLHFPITKNIYLSLIFLLQF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain