SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g04110

Feature Type:gene_model
Chromosome:Gm04
Start:3019987
stop:3021151
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g04110
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G45474AT Annotation by Michelle Graham. TAIR10: photosystem I light harvesting complex gene 5 | chr1:17179353-17180439 FORWARD LENGTH=256 SoyBaseE_val: 1.00E-42ISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0009657GO-bp Annotation by Michelle Graham. GO Biological Process: plastid organization SoyBaseN/AISS
GO:0009765GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light harvesting SoyBaseN/AISS
GO:0009768GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light harvesting in photosystem I SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009782GO-cc Annotation by Michelle Graham. GO Cellular Compartment: photosystem I antenna complex SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0030076GO-cc Annotation by Michelle Graham. GO Cellular Compartment: light-harvesting complex SoyBaseN/AISS
GO:0031409GO-mf Annotation by Michelle Graham. GO Molecular Function: pigment binding SoyBaseN/AISS
PTHR21649Panther CHLOROPHYLL A/B BINDING PROTEIN JGI ISS
PF00504PFAM Chlorophyll A-B binding protein JGI ISS
UniRef100_G7J6D2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Chlorophyll a-b binding protein n=1 Tax=Medicago truncatula RepID=G7J6D2_MEDTR SoyBaseE_val: 3.00E-44ISS
UniRef100_I1JTJ2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JTJ2_SOYBN SoyBaseE_val: 1.00E-67ISS

Expression Patterns of Glyma04g04110
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g04110 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma04g04110
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g04110
>Glyma04g04110.1   sequence type=CDS   gene model=Glyma04g04110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTGGGGTCTTCGGAATTCTGGTGACAGATCTACTTCGCGTCACAGGAATTAACAAGATACCAGTTTGGTTTGAAGCTGGTGCAGTAAAGTACGACTTTGCCAATACAAAGACACTCTTCCTTGTTCAACTACTTCTGATGGGGTTTGTGGAAACAAAAAGGTACATGGATTTTGTTAGTCCTGGATCTCAAGCTAAAGAGGGGTCTTTCTTTGGATTGGAAGCTTCACTGAAAGGCTTAGAGCCAGGGTATTTACATTTTCCAATAACAAAAAATATATATTTGTCTCTTATCTTTCTCCTTCAGTTTTGA
Predicted protein sequences of Glyma04g04110
>Glyma04g04110.1   sequence type=predicted peptide   gene model=Glyma04g04110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLGVFGILVTDLLRVTGINKIPVWFEAGAVKYDFANTKTLFLVQLLLMGFVETKRYMDFVSPGSQAKEGSFFGLEASLKGLEPGYLHFPITKNIYLSLIFLLQF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo