SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g04011

Feature Type:gene_model
Chromosome:Gm04
Start:2936067
stop:2936563
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g04011
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G00730AT Annotation by Michelle Graham. TAIR10: Homeobox-leucine zipper family protein / lipid-binding START domain-containing protein | chr4:301071-304103 REVERSE LENGTH=570 SoyBaseE_val: 8.00E-18ISS
GO:0006473GO-bp Annotation by Michelle Graham. GO Biological Process: protein acetylation SoyBaseN/AISS
GO:0042335GO-bp Annotation by Michelle Graham. GO Biological Process: cuticle development SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0048364GO-bp Annotation by Michelle Graham. GO Biological Process: root development SoyBaseN/AISS
GO:0048765GO-bp Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
UniRef100_B9RDL2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Homeobox protein, putative n=1 Tax=Ricinus communis RepID=B9RDL2_RICCO SoyBaseE_val: 1.00E-28ISS
UniRef100_I1L6R2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L6R2_SOYBN SoyBaseE_val: 2.00E-44ISS

Expression Patterns of Glyma04g04011
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g04011 not represented in the dataset
Glyma04g04011 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g04011 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma04g04011
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g04011
>Glyma04g04011.1   sequence type=CDS   gene model=Glyma04g04011   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCAACTCCCCTGGCCTTTCTCTTGCACTTCAAAGTGATATAGATGGAAAAAGGGATGTGAACAGATTAATGCCCGAGAATTTCGAGCAGAATGGTTTGAGAAGGAACCGGGAAGAGGTGCATGAAAGCAGATCTGGAAGTGACAACATGGATGGTGGTTCTGGTGATGATTTTGATGCTGCCGACAACCCACCAAGGAAAAAATGCTATCACCGACACACTCATAAGCTGATTCAAGAGCTTGAATTGTAG
Predicted protein sequences of Glyma04g04011
>Glyma04g04011.1   sequence type=predicted peptide   gene model=Glyma04g04011   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFNSPGLSLALQSDIDGKRDVNRLMPENFEQNGLRRNREEVHESRSGSDNMDGGSGDDFDAADNPPRKKCYHRHTHKLIQELEL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo