|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G00730 | AT | Annotation by Michelle Graham. TAIR10: Homeobox-leucine zipper family protein / lipid-binding START domain-containing protein | chr4:301071-304103 REVERSE LENGTH=570 | SoyBase | E_val: 8.00E-18 | ISS |
| GO:0006473 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein acetylation | SoyBase | N/A | ISS |
| GO:0042335 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cuticle development | SoyBase | N/A | ISS |
| GO:0043481 | GO-bp | Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light | SoyBase | N/A | ISS |
| GO:0048364 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root development | SoyBase | N/A | ISS |
| GO:0048765 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0003700 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity | SoyBase | N/A | ISS |
| GO:0043565 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding | SoyBase | N/A | ISS |
| UniRef100_B9RDL2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Homeobox protein, putative n=1 Tax=Ricinus communis RepID=B9RDL2_RICCO | SoyBase | E_val: 1.00E-28 | ISS |
| UniRef100_I1L6R2 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L6R2_SOYBN | SoyBase | E_val: 2.00E-44 | ISS |
|
Glyma04g04011 not represented in the dataset |
Glyma04g04011 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma04g04011.1 sequence type=CDS gene model=Glyma04g04011 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTTCAACTCCCCTGGCCTTTCTCTTGCACTTCAAAGTGATATAGATGGAAAAAGGGATGTGAACAGATTAATGCCCGAGAATTTCGAGCAGAATGGTTTGAGAAGGAACCGGGAAGAGGTGCATGAAAGCAGATCTGGAAGTGACAACATGGATGGTGGTTCTGGTGATGATTTTGATGCTGCCGACAACCCACCAAGGAAAAAATGCTATCACCGACACACTCATAAGCTGATTCAAGAGCTTGAATTGTAG
>Glyma04g04011.1 sequence type=predicted peptide gene model=Glyma04g04011 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MFNSPGLSLALQSDIDGKRDVNRLMPENFEQNGLRRNREEVHESRSGSDNMDGGSGDDFDAADNPPRKKCYHRHTHKLIQELEL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||