Glyma04g03940 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g03940

Feature Type:	gene_model
Chromosome:	Gm04
Start:	2878953
stop:	2886977
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g03940

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G26540	AT	Annotation by Michelle Graham. TAIR10: uroporphyrinogen-III synthase family protein \| chr2:11287666-11290224 REVERSE LENGTH=321	SoyBase	E_val: 1.00E-115	ISS
GO:0006779	GO-bp	Annotation by Michelle Graham. GO Biological Process: porphyrin-containing compound biosynthetic process	SoyBase	N/A	ISS
GO:0006780	GO-bp	Annotation by Michelle Graham. GO Biological Process: uroporphyrinogen III biosynthetic process	SoyBase	N/A	ISS
GO:0033014	GO-bp	Annotation by Michelle Graham. GO Biological Process: tetrapyrrole biosynthetic process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0004852	GO-mf	Annotation by Michelle Graham. GO Molecular Function: uroporphyrinogen-III synthase activity	SoyBase	N/A	ISS
PF02602	PFAM	Uroporphyrinogen-III synthase HemD	JGI		ISS
UniRef100_G7J5U1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Uroporphyrinogen-III synthase n=1 Tax=Medicago truncatula RepID=G7J5U1_MEDTR	SoyBase	E_val: 4.00E-156	ISS
UniRef100_I1JTH4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1JTH4_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma04g03940

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g03940

Paralog	Evidence	Comments
Glyma06g04065	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g03940 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g037000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g03940

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g03940

Limit To All Plant Sequences

>Glyma04g03940.2   sequence type=CDS   gene model=Glyma04g03940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCCCATTTTTCTCTCTCCCCTCTCTCCTGTGCACCTTCTCCTCTCCCACCTCGCCGCCGAATCTTTCTCGCTCCTCCCCGAACCGCCGCATCTTCCGCCACCGACGCCGCTTCCTCTTCTACTTCCTCTTCCGCTTCGAATTTCGCTCCCAAAGTCGTCGTCACCAGAGAGCGCGGCAAGAACGCCAAGCTTATCGCCGCTCTGGCTAAACATGAAATCAATTGTTTGGAGCTTCCTCTCATTGAGCACATTCAAGGACCTGATTTAGGCAGGCTTCCTTCTGTATTAGGTGACAATGCATTTGATTGGGTTGTGATAACGTCTCCAGAGGCAGGTTCTGTCTTTCTAGAGGCATGGAGATCTTCTGGGATGCCTCATGTCAAAATAGGTGTTGTTGGGGCTGGTACTGCAAGCATTTTCAAGGAAGCTTTGCAGTCTTCAAACCGATCAATTGATATTGCCTTTGTGCCATCAAAAGCAACAGGAAAGGTTTTGGCTACTGAGCTTCCTAAGATTGGAAATAAATGCACCGTTCTCTATCCTGCTTCTGCAAAGGCTAGCAATGAGATTGAGGAAGGACTTTCAAACCGTGGATTTGAGGTTACTAGGATGAATACATATACAACGGTGCCAGTTCAACATGTTGACCATACGGTTCTAAAGATAGCACTTGCTGCCCCTGTTGTTACAGTAGCTTCACCATCTTCTATTCGTGCCTGGAAGAATCTTCTTTCAGATTCTGAGTGGAACAATTCTGTTGCATGCATTGGTGAGACAACTGCTACAATGGCAAGAAGTTTAGGTTTCACAAATGTGTACTATCCAGCACAACCAGGCATCGAAGGCTGGGTAGAAAGCATTCTTGAAGCATTAGGTTCCTATGATGAATTATTGAGGTAG

Predicted protein sequences of Glyma04g03940

Limit To All Plant Sequences

>Glyma04g03940.2   sequence type=predicted peptide   gene model=Glyma04g03940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPHFSLSPLSCAPSPLPPRRRIFLAPPRTAASSATDAASSSTSSSASNFAPKVVVTRERGKNAKLIAALAKHEINCLELPLIEHIQGPDLGRLPSVLGDNAFDWVVITSPEAGSVFLEAWRSSGMPHVKIGVVGAGTASIFKEALQSSNRSIDIAFVPSKATGKVLATELPKIGNKCTVLYPASAKASNEIEEGLSNRGFEVTRMNTYTTVPVQHVDHTVLKIALAAPVVTVASPSSIRAWKNLLSDSEWNNSVACIGETTATMARSLGFTNVYYPAQPGIEGWVESILEALGSYDELLR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain