Glyma04g03900 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g03900

Feature Type:	gene_model
Chromosome:	Gm04
Start:	2838830
stop:	2840287
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g03900

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G15770	AT	Annotation by Michelle Graham. TAIR10: Cupredoxin superfamily protein \| chr2:6871257-6872245 REVERSE LENGTH=301	SoyBase	E_val: 6.00E-26	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
PF02298	PFAM	Plastocyanin-like domain	JGI		ISS
UniRef100_I1JTH0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JTH0_SOYBN	SoyBase	E_val: 1.00E-102	ISS
UniRef100_Q9XIL0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Auxin response factor 30 n=1 Tax=Arabidopsis thaliana RepID=Q9XIL0_ARATH	SoyBase	E_val: 3.00E-23	ISS

Expression Patterns of Glyma04g03900

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g03900

Paralog	Evidence	Comments
Glyma06g04000	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g03900 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g036600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g03900

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g03900

Limit To All Plant Sequences

>Glyma04g03900.1   sequence type=CDS   gene model=Glyma04g03900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGCCACTAGAATTTTGGCACAAGGAGTGTTTGTGTTCCTTGTGATAACGTATGTGGGCGCGGAGAGAGAGCCCAGAACCATTTTGGTTGGAGACTCTCAAGGCTGGCAAGCCGGCACTAACTACACCCAATGGGCCATCCAAAATAGCCCCTTCCACATAAATGACACACTTGTGTTCAAGTATCCAGGGAACTCCACGACGCTGGCTCAGAGTGTGTACTTACTACCAAACCAGTGGAGCTACATAACGTGCGAATTCAGAGGGGCAAAGCTGTTGGGGAACGCAACTGAGGGTGATGGTGAGGGCTTTAAGGTTGAACTGAATCAGTTGACACCTTATTACTTTGCCTCTGCAGAAGGCAACTTTTATGATTGCATTGCTGGTCTCTCCAAGTTCATTGCCGTGCCATCAACAAGCTCTGGCTCCTCTTAG

Predicted protein sequences of Glyma04g03900

Limit To All Plant Sequences

>Glyma04g03900.1   sequence type=predicted peptide   gene model=Glyma04g03900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDATRILAQGVFVFLVITYVGAEREPRTILVGDSQGWQAGTNYTQWAIQNSPFHINDTLVFKYPGNSTTLAQSVYLLPNQWSYITCEFRGAKLLGNATEGDGEGFKVELNQLTPYYFASAEGNFYDCIAGLSKFIAVPSTSSGSS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain