Glyma04g03890 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g03890

Feature Type:	gene_model
Chromosome:	Gm04
Start:	2835827
stop:	2836937
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g03890

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G26520	AT	Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G57500.1); Has 51 Blast hits to 51 proteins in 11 species: Archae - 0; Bacteria - 1; Metazoa - 0; Fungi - 0; Plants - 50; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr2:11280280-11280717 FORWARD LENGTH=145	SoyBase	E_val: 8.00E-23	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_I1JTG9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JTG9_SOYBN	SoyBase	E_val: 4.00E-81	ISS
UniRef100_O48719	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Arabidopsis thaliana RepID=O48719_ARATH	SoyBase	E_val: 4.00E-20	ISS

Expression Patterns of Glyma04g03890

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g03890

Paralog	Evidence	Comments
Glyma06g03990	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g03890 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g036500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g03890

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g03890

Limit To All Plant Sequences

>Glyma04g03890.1   sequence type=CDS   gene model=Glyma04g03890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAACAATGCCAATGTACCAACAACAAGAACAACCTCCTCCAATGATCAGTGTGACACAACAATCATCACATGAGTCCATTGGTCCCTTGATTGGAGTTCTGGTCGTTGTAATTGTTTTGGGCGTAATTGCTGTTATGATTGGAAGGCTTTGTTCAGGAAGAAGAATCATGGGGCATGGCCAATACGATGTTGAAAGCTGGGCAGAGAGAAAGTGTTCATCTTGCATTGATGGCAGAATTAACCTCTCACTTCCCACAAGAGTCAGTGAGTCAAGCAACTCAGTTCCTGCAACACCCATCCACGCTTGTCAAGAAACCAAGCGACCAGAACAATCTTCTCAGACATCGCCACCTAACCTTTGA

Predicted protein sequences of Glyma04g03890

Limit To All Plant Sequences

>Glyma04g03890.1   sequence type=predicted peptide   gene model=Glyma04g03890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSTMPMYQQQEQPPPMISVTQQSSHESIGPLIGVLVVVIVLGVIAVMIGRLCSGRRIMGHGQYDVESWAERKCSSCIDGRINLSLPTRVSESSNSVPATPIHACQETKRPEQSSQTSPPNL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain