SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g03876): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g03876): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g03876

Feature Type:gene_model
Chromosome:Gm04
Start:2828355
stop:2829030
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G80260AT Annotation by Michelle Graham. TAIR10: Spc97 / Spc98 family of spindle pole body (SBP) component | chr1:30175924-30180511 FORWARD LENGTH=995 SoyBaseE_val: 3.00E-23ISS
GO:0000226GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0000922GO-cc Annotation by Michelle Graham. GO Cellular Compartment: spindle pole SoyBaseN/AISS
GO:0005815GO-cc Annotation by Michelle Graham. GO Cellular Compartment: microtubule organizing center SoyBaseN/AISS
GO:0015631GO-mf Annotation by Michelle Graham. GO Molecular Function: tubulin binding SoyBaseN/AISS
PTHR19302Panther GAMMA TUBULIN COMPLEX PROTEIN JGI ISS
PTHR19302:SF9Panther gb def: gamma-tubulin interacting protein-like [arabidopsis thaliana] JGI ISS
PF04130PFAM Spc97 / Spc98 family JGI ISS
UniRef100_G7J5S9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Gamma-tubulin complex component 4 n=1 Tax=Medicago truncatula RepID=G7J5S9_MEDTR SoyBaseE_val: 5.00E-30ISS
UniRef100_I1JTG7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JTG7_SOYBN SoyBaseE_val: 6.00E-69ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g03876 not represented in the dataset

Glyma04g03876 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g03876.1   sequence type=CDS   gene model=Glyma04g03876   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGCTTTATATGTATGTTGGAAGCTTGTTGCCATACATTGAGGGTCTTGATTCCTGGCTTTTTGAAGGAATTCTTGATGATCCTTTTGGTGAGATGTCCTTTTTTACTGATAAAGAAGTCTCAGTTGATGAGGCTGAGTTCTGGGAGAAGAGTTATTTGTTAAGAAGGCTACAGCATAGCAAATTAGATTCAGAATTCTTCTCTTCCACGAATTATGTCAATGATCCTGTGCCAGCATCAAATGACAAGGAAATGGATAGGAGAATTCCATCTCTTTGTCTAGTACAGTTAAAGGAAAAGAGCAGGGCATTTGAGATCGTCCAGCCTGTCCTTTTTTTATTAAGGATTTAA

>Glyma04g03876.1   sequence type=predicted peptide   gene model=Glyma04g03876   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVLYMYVGSLLPYIEGLDSWLFEGILDDPFGEMSFFTDKEVSVDEAEFWEKSYLLRRLQHSKLDSEFFSSTNYVNDPVPASNDKEMDRRIPSLCLVQLKEKSRAFEIVQPVLFLLRI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo