SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g03820

Feature Type:gene_model
Chromosome:Gm04
Start:2785259
stop:2786232
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g03820
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G26500AT Annotation by Michelle Graham. TAIR10: cytochrome b6f complex subunit (petM), putative | chr2:11270370-11270747 FORWARD LENGTH=125 SoyBaseE_val: 2.00E-36ISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0009657GO-bp Annotation by Michelle Graham. GO Biological Process: plastid organization SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009512GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytochrome b6f complex SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009496GO-mf Annotation by Michelle Graham. GO Molecular Function: plastoquinol--plastocyanin reductase activity SoyBaseN/AISS
PF08041PFAM PetM family of cytochrome b6f complex subunit 7 JGI ISS
UniRef100_B9R7K1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Plastoquinol-plastocyanin reductase, putative n=1 Tax=Ricinus communis RepID=B9R7K1_RICCO SoyBaseE_val: 3.00E-41ISS
UniRef100_C6SZQ6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SZQ6_SOYBN SoyBaseE_val: 7.00E-80ISS

Expression Patterns of Glyma04g03820
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g03820
ParalogEvidenceComments
Glyma06g03920 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g03820 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g035900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g03820
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g03820
>Glyma04g03820.1   sequence type=CDS   gene model=Glyma04g03820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTATGGCCACAGCTGTCGTGTGTCCTCAGAACATCACCGGAGCCATCGTGAGCTCACCTAGCAAGACCAAGAAGAGAGTGGTACACGTGAGAGGCATAAATTCATTTGGGGGACTGAAGGCTAGCAATGGTGTTGTCTCTTTGGGGATTCCTATGAGCACTGAGAAGTGCTTTGCTAAGGTTGTGAGCTCAGTGAAAGCAGCTACATCAAATGGGAAAGGAAAAGGAGGGGCTCTTTCTTCCACGTGCAACGCTGCTGGTGAGATATTCACGATTGCTGCTATCATCAATGGACTTGTTCTTGTCGGGGTTGCTGTTGGCTTTGTGCTCTTGCGAGTTGAAGCATGGGTCGAGGAGTCCGAGGCAGAGTGA
Predicted protein sequences of Glyma04g03820
>Glyma04g03820.1   sequence type=predicted peptide   gene model=Glyma04g03820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAMATAVVCPQNITGAIVSSPSKTKKRVVHVRGINSFGGLKASNGVVSLGIPMSTEKCFAKVVSSVKAATSNGKGKGGALSSTCNAAGEIFTIAAIINGLVLVGVAVGFVLLRVEAWVEESEAE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo