SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g03801

Feature Type:gene_model
Chromosome:Gm04
Start:2769542
stop:2773111
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g03801
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G42630AT Annotation by Michelle Graham. TAIR10: Homeodomain-like superfamily protein | chr5:17073997-17075747 REVERSE LENGTH=276 SoyBaseE_val: 3.00E-48ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0080060GO-bp Annotation by Michelle Graham. GO Biological Process: integument development SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0044212GO-mf Annotation by Michelle Graham. GO Molecular Function: transcription regulatory region DNA binding SoyBaseN/AISS
PF00249PFAM Myb-like DNA-binding domain JGI ISS
UniRef100_G7I588UniRef Annotation by Michelle Graham. Most informative UniRef hit: Myb family transcription factor-like protein n=1 Tax=Medicago truncatula RepID=G7I588_MEDTR SoyBaseE_val: 6.00E-83ISS
UniRef100_UPI000233938FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233938F related cluster n=1 Tax=unknown RepID=UPI000233938F SoyBaseE_val: 2.00E-177ISS

Expression Patterns of Glyma04g03801
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g03801 not represented in the dataset
Glyma04g03801 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g03801
ParalogEvidenceComments
Glyma06g03901 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g03801 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g035700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g03801
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g03801
>Glyma04g03801.1   sequence type=CDS   gene model=Glyma04g03801   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTACACTACTTCGCATACAGAAATGCCAACCTTTGCACCCTTGCCAGAGCCAGATCTCTCCTTAAACATAAGCCCACCCTTCACTTCAGATTCTGACGCCAAAAAAGTGGAAATAAGCTGCAACGGATTATTAACATTAACTACAAAAACGCTTTACAACGATATGTGCTCAACCTCGGATTCTGGTAGCAGTGGAAGCGATTTAAGCCACGAAAATGGTTTTTTCGGCCACACGGACACTGCCTACAACCTTGGCCATCATGAACCGACATTGAGCTTAGGCATCGAAACGACAAATTCGAATCCTTATCCTGTCCAACAAGGAGCACTCTCGAGAAACAACTTCAGTCACTTCCACAACTACCAACCTCACAGCAATACTCTGGATTTCAAGCGAAATGCTAGAGTCATTCATGGCGTGAAAAGAAACGCCAGAGCTCCTAGAATGCGATGGACTACGACCCTCCATGCTCATTTTGTTCATGCGGTTCAGCTTCTTGGTGGTCATGAAAGGGCAACTCCGAAGTCAGTGTTAGAGTTGATGAATGTTAAAGATCTAACTCTATCTCACGTGAAGAGTCACTTGCAGATGTATAGAACAGTGAAGAGCTCTGACAAAGGCAGCGCAGGATATGGGCAGACAGGTATAGGGTTGAGCCAAAAGCCAGGAATTGTCGATCTGTATGGAGTCTTAGCTTGTGAGAGAGCCAATTTGCCACAGCCGCTGCTAAAATCCCAAAGGGCGTCATGGCAATCATCAATAGAGACAAATTCAATAAATTATACACAGAACCCCATAATCAATTCGATGTATTCTCATCTCAAAGGAAACCAAACCATGGTGGGTGGACAGCATTATGAATGTCTGTCAAATTGCATGAAGGAGAAATTGGATTCTTGCTCTTTGTCACGTTCCGATATGACGCTTGACCTAGAATTTACCCTTGGAAGGTCCACTAGTTGCAAACAGACCACGCTGAATCAAGAGAATTAA
Predicted protein sequences of Glyma04g03801
>Glyma04g03801.1   sequence type=predicted peptide   gene model=Glyma04g03801   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYTTSHTEMPTFAPLPEPDLSLNISPPFTSDSDAKKVEISCNGLLTLTTKTLYNDMCSTSDSGSSGSDLSHENGFFGHTDTAYNLGHHEPTLSLGIETTNSNPYPVQQGALSRNNFSHFHNYQPHSNTLDFKRNARVIHGVKRNARAPRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLSHVKSHLQMYRTVKSSDKGSAGYGQTGIGLSQKPGIVDLYGVLACERANLPQPLLKSQRASWQSSIETNSINYTQNPIINSMYSHLKGNQTMVGGQHYECLSNCMKEKLDSCSLSRSDMTLDLEFTLGRSTSCKQTTLNQEN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo