SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g03661

Feature Type:gene_model
Chromosome:Gm04
Start:2686785
stop:2687669
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g03661
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G75030AT Annotation by Michelle Graham. TAIR10: thaumatin-like protein 3 | chr1:28174418-28175255 FORWARD LENGTH=246 SoyBaseE_val: 2.00E-93ISS
GO:0051707GO-bp Annotation by Michelle Graham. GO Biological Process: response to other organism SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF00314PFAM Thaumatin family JGI ISS
UniRef100_B9R7P7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Zeamatin, putative n=1 Tax=Ricinus communis RepID=B9R7P7_RICCO SoyBaseE_val: 2.00E-101ISS
UniRef100_I1M8G0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1M8G0_SOYBN SoyBaseE_val: 2.00E-105ISS

Expression Patterns of Glyma04g03661
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g03661 not represented in the dataset
Glyma04g03661 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g03661 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g034300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g03661
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g03661
>Glyma04g03661.1   sequence type=CDS   gene model=Glyma04g03661   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCACAGAGTTATAGCAGAAACTTCTCTATTCCTCCTCCTCCTGTTTTCATTAGGTAACCTAGCTTCAGCCACAATGTTCACCATCGAAAACCGTTGCAGCTACACGGTCTGGCCCGGAACCCTCGCCGGCAATGGCGCCGCCGTTCTCGGCGACGGCGGGTTTCCCCTACCGACGGGAACGTCCGTCCGACTCGCAGCTCCGGCGGGCTGGTCGGGGCGCTGCGCCGGCGGGATGAAGTGCACCGGGGGAGGCGTGCCGCCGGTGACGTTGGCGGAGTTCACGATCGGAACCGGGTCCGCCCAGGACTTCTACGACGTGAGTTTGGTGGACGGTTACAACGTGGCGATGGGGGTGAGGGCAACCGGAGGAACCGGTAACTGCCAGTACGCGGGGTGCGTTACGGACTTGAACGGTAAGTGCCCCACCGAGTTGCAGGTTACGGCGGAGGGAGGGTCGATTGTGGCGTGCAAGAGCGCGTGCGCGGCGTTCAACGCGGCGGAGTTTTGCTGCACCGGTGAGTACTCGACGCCGCAGACTTGCAAGCCGACGCAATACTCGGAGATATTCAAGAGTGCATGTCCCTCGGCGTATAGTTACGCTTACGATGATGCTACCAGCACTTGCACGTGCTCTGCCTCCGATTACGTTATCACTTTTTGTCCTAACTAA
Predicted protein sequences of Glyma04g03661
>Glyma04g03661.1   sequence type=predicted peptide   gene model=Glyma04g03661   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHRVIAETSLFLLLLFSLGNLASATMFTIENRCSYTVWPGTLAGNGAAVLGDGGFPLPTGTSVRLAAPAGWSGRCAGGMKCTGGGVPPVTLAEFTIGTGSAQDFYDVSLVDGYNVAMGVRATGGTGNCQYAGCVTDLNGKCPTELQVTAEGGSIVACKSACAAFNAAEFCCTGEYSTPQTCKPTQYSEIFKSACPSAYSYAYDDATSTCTCSASDYVITFCPN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo