Warning : Undefined variable $sxsome in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : Undefined variable $sstart in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : Undefined variable $send in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1018
Warning : get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g03210): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1018
Warning : Trying to access array offset on false in
/var/www/html/include/SeqFeatClass.php on line
1019
Warning : get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1020
Warning : get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g03210): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1020
Warning : Trying to access array offset on false in
/var/www/html/include/SeqFeatClass.php on line
1021
Deprecated : preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in
/var/www/html/include/SeqFeatClass.php on line
1025
Deprecated : preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in
/var/www/html/include/SeqFeatClass.php on line
1031
Report for Sequence Feature Glyma04g03210
Feature Type: gene_model
Chromosome: Gm04
Start: 2347024
stop: 2349849
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g03210
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G10210 AT
Annotation by Michelle Graham. TAIR10: mitogen-activated protein kinase 1 | chr1:3349579-3350776 FORWARD LENGTH=370
SoyBase E_val: 0 ISS
GO:0000165 GO-bp
Annotation by Michelle Graham. GO Biological Process: MAPK cascade
SoyBase N/A ISS
GO:0000303 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to superoxide
SoyBase N/A ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0006468 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein phosphorylation
SoyBase N/A ISS
GO:0006612 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane
SoyBase N/A ISS
GO:0006635 GO-bp
Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation
SoyBase N/A ISS
GO:0006970 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to osmotic stress
SoyBase N/A ISS
GO:0007165 GO-bp
Annotation by Michelle Graham. GO Biological Process: signal transduction
SoyBase N/A ISS
GO:0008219 GO-bp
Annotation by Michelle Graham. GO Biological Process: cell death
SoyBase N/A ISS
GO:0009409 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to cold
SoyBase N/A ISS
GO:0009617 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to bacterium
SoyBase N/A ISS
GO:0009651 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to salt stress
SoyBase N/A ISS
GO:0009733 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus
SoyBase N/A ISS
GO:0009734 GO-bp
Annotation by Michelle Graham. GO Biological Process: auxin mediated signaling pathway
SoyBase N/A ISS
GO:0009737 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus
SoyBase N/A ISS
GO:0009743 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to carbohydrate stimulus
SoyBase N/A ISS
GO:0009751 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus
SoyBase N/A ISS
GO:0009755 GO-bp
Annotation by Michelle Graham. GO Biological Process: hormone-mediated signaling pathway
SoyBase N/A ISS
GO:0009862 GO-bp
Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway
SoyBase N/A ISS
GO:0009863 GO-bp
Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway
SoyBase N/A ISS
GO:0009867 GO-bp
Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway
SoyBase N/A ISS
GO:0009873 GO-bp
Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway
SoyBase N/A ISS
GO:0010310 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process
SoyBase N/A ISS
GO:0010363 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response
SoyBase N/A ISS
GO:0010374 GO-bp
Annotation by Michelle Graham. GO Biological Process: stomatal complex development
SoyBase N/A ISS
GO:0016558 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein import into peroxisome matrix
SoyBase N/A ISS
GO:0031348 GO-bp
Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response
SoyBase N/A ISS
GO:0035304 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation
SoyBase N/A ISS
GO:0035556 GO-bp
Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction
SoyBase N/A ISS
GO:0043069 GO-bp
Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death
SoyBase N/A ISS
GO:0048481 GO-bp
Annotation by Michelle Graham. GO Biological Process: ovule development
SoyBase N/A ISS
GO:0051707 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to other organism
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0004672 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein kinase activity
SoyBase N/A ISS
GO:0004674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity
SoyBase N/A ISS
GO:0004707 GO-mf
Annotation by Michelle Graham. GO Molecular Function: MAP kinase activity
SoyBase N/A ISS
GO:0005524 GO-mf
Annotation by Michelle Graham. GO Molecular Function: ATP binding
SoyBase N/A ISS
GO:0016301 GO-mf
Annotation by Michelle Graham. GO Molecular Function: kinase activity
SoyBase N/A ISS
GO:0016772 GO-mf
Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups
SoyBase N/A ISS
KOG0660
KOG
Mitogen-activated protein kinase
JGI ISS
PTHR24055 Panther
MITOGEN-ACTIVATED PROTEIN KINASE
JGI ISS
PF00069 PFAM
Protein kinase domain
JGI ISS
UniRef100_C6TAM5 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TAM5_SOYBN
SoyBase E_val: 0 ISS
UniRef100_Q9M6R8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: MAP kinase PsMAPK2 n=1 Tax=Pisum sativum RepID=Q9M6R8_PEA
SoyBase E_val: 0 ISS
Expression Patterns of Glyma04g03210
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma04g03210
Paralog Evidence Comments
Glyma06g03270 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g03210 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g029700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g03210
Coding sequences of Glyma04g03210
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g03210.1 sequence type=CDS gene model=Glyma04g03210 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCGACTCCTGTTGAGCCTCCTAACGGGATCAGAACTGAAGGGAAGCATTATTATTCCATGTGGCAAACCCTGTTTGAGTTTGATTCAAAATACGTGCCCATCAAGCCAATTGGCCGCGGAGCATATGGGATTGTGTGCTCTTCTGTGAATAGAGAGACAAATGAGAAGGTTGCCATCAAGAAGATACAGAATGCCTTTGAAAACCGGGTTGATGCACTGAGGACTTTGCGCGAACTCAAGCTTCTTCGCCACCTTCACCATGAGAATGTGATTGCTTTGAAGGATATCATGATGCCTGTTCATAGGAATAGTTTCAAGGATGTCTATCTAGTTTATGAACTCATGGACACGGATTTGCATCAGATTATTAAGTCTTCTCAAGCTTTGTCTAATGATCACTGCCAGTATTTCCTCTTTCAGTTGCTCCGTGGCTTGAAATATCTTCACTCAGCTAACATCCTTCATCGTGACTTGAAACCTGGGAATCTTCTAATTAATGCAAATTGTGACCTAAAAATATGCGATTTTGGGTTAGCACGTACTAACTGCAGCAAGAACCAGTTCATGACCGAGTATGTTGTCACTCGGTGGTATAGGGCACCAGAGCTCCTACTCTGCTGTGACAACTATGGGACATCTATTGATGTTTGGTCAGTTGGATGCATCTTTGCAGAGCTTCTTGGCCGAAAACCGATTTTCCCTGGTTCAGAGTGTCTCAACCAGCTGAAGTTGATTATCAATATCCTTGGTAGTCAGAGGGAGGAGGATATTGAATTCATTGATAATCCAAAGGCAAAGAAGTATATCAAATCACTTCCTTATTCTCCTGGAAGCCCCTTTTCGCGACTTTATCCTAATGCGCATCCATTAGCAATTGATCTTCTTGCAAAGATGCTTGTTTTTGATCCAACCAAGAGGATTAGTGTCACTGAAGCACTTCAACACCCTTACATGGCCCCTCTGTATGATCCTAACTGTGACCCTCCAGCTGTCATTCCAATTGATCTTGACATTGATGAGGATCTAGGGGAAGAGATGATAAGGGAGATGATGTGGAAAGAAATGCTTCATTACCATCCCGAATCTGCGATGGAGAATGCAGGGTTGTGCTAA
Predicted protein sequences of Glyma04g03210
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g03210.1 sequence type=predicted peptide gene model=Glyma04g03210 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MATPVEPPNGIRTEGKHYYSMWQTLFEFDSKYVPIKPIGRGAYGIVCSSVNRETNEKVAIKKIQNAFENRVDALRTLRELKLLRHLHHENVIALKDIMMPVHRNSFKDVYLVYELMDTDLHQIIKSSQALSNDHCQYFLFQLLRGLKYLHSANILHRDLKPGNLLINANCDLKICDFGLARTNCSKNQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFPGSECLNQLKLIINILGSQREEDIEFIDNPKAKKYIKSLPYSPGSPFSRLYPNAHPLAIDLLAKMLVFDPTKRISVTEALQHPYMAPLYDPNCDPPAVIPIDLDIDEDLGEEMIREMMWKEMLHYHPESAMENAGLC*