SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma04g03210

Feature Type:gene_model
Chromosome:Gm04
Start:2347024
stop:2349849
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G10210AT Annotation by Michelle Graham. TAIR10: mitogen-activated protein kinase 1 | chr1:3349579-3350776 FORWARD LENGTH=370 SoyBaseE_val: 0ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0000303GO-bp Annotation by Michelle Graham. GO Biological Process: response to superoxide SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0008219GO-bp Annotation by Michelle Graham. GO Biological Process: cell death SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009734GO-bp Annotation by Michelle Graham. GO Biological Process: auxin mediated signaling pathway SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009743GO-bp Annotation by Michelle Graham. GO Biological Process: response to carbohydrate stimulus SoyBaseN/AISS
GO:0009751GO-bp Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus SoyBaseN/AISS
GO:0009755GO-bp Annotation by Michelle Graham. GO Biological Process: hormone-mediated signaling pathway SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0009873GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0010374GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal complex development SoyBaseN/AISS
GO:0016558GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into peroxisome matrix SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0051707GO-bp Annotation by Michelle Graham. GO Biological Process: response to other organism SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004707GO-mf Annotation by Michelle Graham. GO Molecular Function: MAP kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
KOG0660 KOG Mitogen-activated protein kinase JGI ISS
PTHR24055Panther MITOGEN-ACTIVATED PROTEIN KINASE JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
UniRef100_C6TAM5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TAM5_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q9M6R8UniRef Annotation by Michelle Graham. Most informative UniRef hit: MAP kinase PsMAPK2 n=1 Tax=Pisum sativum RepID=Q9M6R8_PEA SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g03270 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g029700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g03210.1   sequence type=CDS   gene model=Glyma04g03210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGACTCCTGTTGAGCCTCCTAACGGGATCAGAACTGAAGGGAAGCATTATTATTCCATGTGGCAAACCCTGTTTGAGTTTGATTCAAAATACGTGCCCATCAAGCCAATTGGCCGCGGAGCATATGGGATTGTGTGCTCTTCTGTGAATAGAGAGACAAATGAGAAGGTTGCCATCAAGAAGATACAGAATGCCTTTGAAAACCGGGTTGATGCACTGAGGACTTTGCGCGAACTCAAGCTTCTTCGCCACCTTCACCATGAGAATGTGATTGCTTTGAAGGATATCATGATGCCTGTTCATAGGAATAGTTTCAAGGATGTCTATCTAGTTTATGAACTCATGGACACGGATTTGCATCAGATTATTAAGTCTTCTCAAGCTTTGTCTAATGATCACTGCCAGTATTTCCTCTTTCAGTTGCTCCGTGGCTTGAAATATCTTCACTCAGCTAACATCCTTCATCGTGACTTGAAACCTGGGAATCTTCTAATTAATGCAAATTGTGACCTAAAAATATGCGATTTTGGGTTAGCACGTACTAACTGCAGCAAGAACCAGTTCATGACCGAGTATGTTGTCACTCGGTGGTATAGGGCACCAGAGCTCCTACTCTGCTGTGACAACTATGGGACATCTATTGATGTTTGGTCAGTTGGATGCATCTTTGCAGAGCTTCTTGGCCGAAAACCGATTTTCCCTGGTTCAGAGTGTCTCAACCAGCTGAAGTTGATTATCAATATCCTTGGTAGTCAGAGGGAGGAGGATATTGAATTCATTGATAATCCAAAGGCAAAGAAGTATATCAAATCACTTCCTTATTCTCCTGGAAGCCCCTTTTCGCGACTTTATCCTAATGCGCATCCATTAGCAATTGATCTTCTTGCAAAGATGCTTGTTTTTGATCCAACCAAGAGGATTAGTGTCACTGAAGCACTTCAACACCCTTACATGGCCCCTCTGTATGATCCTAACTGTGACCCTCCAGCTGTCATTCCAATTGATCTTGACATTGATGAGGATCTAGGGGAAGAGATGATAAGGGAGATGATGTGGAAAGAAATGCTTCATTACCATCCCGAATCTGCGATGGAGAATGCAGGGTTGTGCTAA

>Glyma04g03210.1   sequence type=predicted peptide   gene model=Glyma04g03210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATPVEPPNGIRTEGKHYYSMWQTLFEFDSKYVPIKPIGRGAYGIVCSSVNRETNEKVAIKKIQNAFENRVDALRTLRELKLLRHLHHENVIALKDIMMPVHRNSFKDVYLVYELMDTDLHQIIKSSQALSNDHCQYFLFQLLRGLKYLHSANILHRDLKPGNLLINANCDLKICDFGLARTNCSKNQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFPGSECLNQLKLIINILGSQREEDIEFIDNPKAKKYIKSLPYSPGSPFSRLYPNAHPLAIDLLAKMLVFDPTKRISVTEALQHPYMAPLYDPNCDPPAVIPIDLDIDEDLGEEMIREMMWKEMLHYHPESAMENAGLC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo