Glyma04g03210 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g03210

Feature Type:	gene_model
Chromosome:	Gm04
Start:	2347024
stop:	2349849
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g03210

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G10210	AT	Annotation by Michelle Graham. TAIR10: mitogen-activated protein kinase 1 \| chr1:3349579-3350776 FORWARD LENGTH=370	SoyBase	E_val: 0	ISS
GO:0000165	GO-bp	Annotation by Michelle Graham. GO Biological Process: MAPK cascade	SoyBase	N/A	ISS
GO:0000303	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to superoxide	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0006468	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein phosphorylation	SoyBase	N/A	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0006635	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation	SoyBase	N/A	ISS
GO:0006970	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to osmotic stress	SoyBase	N/A	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0008219	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell death	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009617	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to bacterium	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0009734	GO-bp	Annotation by Michelle Graham. GO Biological Process: auxin mediated signaling pathway	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009743	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to carbohydrate stimulus	SoyBase	N/A	ISS
GO:0009751	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus	SoyBase	N/A	ISS
GO:0009755	GO-bp	Annotation by Michelle Graham. GO Biological Process: hormone-mediated signaling pathway	SoyBase	N/A	ISS
GO:0009862	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009863	GO-bp	Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009867	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009873	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway	SoyBase	N/A	ISS
GO:0010310	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0010374	GO-bp	Annotation by Michelle Graham. GO Biological Process: stomatal complex development	SoyBase	N/A	ISS
GO:0016558	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into peroxisome matrix	SoyBase	N/A	ISS
GO:0031348	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response	SoyBase	N/A	ISS
GO:0035304	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation	SoyBase	N/A	ISS
GO:0035556	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction	SoyBase	N/A	ISS
GO:0043069	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death	SoyBase	N/A	ISS
GO:0048481	GO-bp	Annotation by Michelle Graham. GO Biological Process: ovule development	SoyBase	N/A	ISS
GO:0051707	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to other organism	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0004672	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein kinase activity	SoyBase	N/A	ISS
GO:0004674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity	SoyBase	N/A	ISS
GO:0004707	GO-mf	Annotation by Michelle Graham. GO Molecular Function: MAP kinase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase activity	SoyBase	N/A	ISS
GO:0016772	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups	SoyBase	N/A	ISS
KOG0660	KOG	Mitogen-activated protein kinase	JGI		ISS
PTHR24055	Panther	MITOGEN-ACTIVATED PROTEIN KINASE	JGI		ISS
PF00069	PFAM	Protein kinase domain	JGI		ISS
UniRef100_C6TAM5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TAM5_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q9M6R8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: MAP kinase PsMAPK2 n=1 Tax=Pisum sativum RepID=Q9M6R8_PEA	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma04g03210

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g03210

Paralog	Evidence	Comments
Glyma06g03270	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g03210 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g029700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g03210

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g03210

Limit To All Plant Sequences

>Glyma04g03210.1   sequence type=CDS   gene model=Glyma04g03210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGACTCCTGTTGAGCCTCCTAACGGGATCAGAACTGAAGGGAAGCATTATTATTCCATGTGGCAAACCCTGTTTGAGTTTGATTCAAAATACGTGCCCATCAAGCCAATTGGCCGCGGAGCATATGGGATTGTGTGCTCTTCTGTGAATAGAGAGACAAATGAGAAGGTTGCCATCAAGAAGATACAGAATGCCTTTGAAAACCGGGTTGATGCACTGAGGACTTTGCGCGAACTCAAGCTTCTTCGCCACCTTCACCATGAGAATGTGATTGCTTTGAAGGATATCATGATGCCTGTTCATAGGAATAGTTTCAAGGATGTCTATCTAGTTTATGAACTCATGGACACGGATTTGCATCAGATTATTAAGTCTTCTCAAGCTTTGTCTAATGATCACTGCCAGTATTTCCTCTTTCAGTTGCTCCGTGGCTTGAAATATCTTCACTCAGCTAACATCCTTCATCGTGACTTGAAACCTGGGAATCTTCTAATTAATGCAAATTGTGACCTAAAAATATGCGATTTTGGGTTAGCACGTACTAACTGCAGCAAGAACCAGTTCATGACCGAGTATGTTGTCACTCGGTGGTATAGGGCACCAGAGCTCCTACTCTGCTGTGACAACTATGGGACATCTATTGATGTTTGGTCAGTTGGATGCATCTTTGCAGAGCTTCTTGGCCGAAAACCGATTTTCCCTGGTTCAGAGTGTCTCAACCAGCTGAAGTTGATTATCAATATCCTTGGTAGTCAGAGGGAGGAGGATATTGAATTCATTGATAATCCAAAGGCAAAGAAGTATATCAAATCACTTCCTTATTCTCCTGGAAGCCCCTTTTCGCGACTTTATCCTAATGCGCATCCATTAGCAATTGATCTTCTTGCAAAGATGCTTGTTTTTGATCCAACCAAGAGGATTAGTGTCACTGAAGCACTTCAACACCCTTACATGGCCCCTCTGTATGATCCTAACTGTGACCCTCCAGCTGTCATTCCAATTGATCTTGACATTGATGAGGATCTAGGGGAAGAGATGATAAGGGAGATGATGTGGAAAGAAATGCTTCATTACCATCCCGAATCTGCGATGGAGAATGCAGGGTTGTGCTAA

Predicted protein sequences of Glyma04g03210

Limit To All Plant Sequences

>Glyma04g03210.1   sequence type=predicted peptide   gene model=Glyma04g03210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATPVEPPNGIRTEGKHYYSMWQTLFEFDSKYVPIKPIGRGAYGIVCSSVNRETNEKVAIKKIQNAFENRVDALRTLRELKLLRHLHHENVIALKDIMMPVHRNSFKDVYLVYELMDTDLHQIIKSSQALSNDHCQYFLFQLLRGLKYLHSANILHRDLKPGNLLINANCDLKICDFGLARTNCSKNQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFPGSECLNQLKLIINILGSQREEDIEFIDNPKAKKYIKSLPYSPGSPFSRLYPNAHPLAIDLLAKMLVFDPTKRISVTEALQHPYMAPLYDPNCDPPAVIPIDLDIDEDLGEEMIREMMWKEMLHYHPESAMENAGLC*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain