Report for Sequence Feature Glyma04g03110
Feature Type: gene_model
Chromosome: Gm04
Start: 2258620
stop: 2260681
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g03110
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G51030 AT
Annotation by Michelle Graham. TAIR10: thioredoxin H-type 1 | chr3:18951123-18951955 REVERSE LENGTH=114
SoyBase E_val: 2.00E-53 ISS
GO:0006662 GO-bp
Annotation by Michelle Graham. GO Biological Process: glycerol ether metabolic process
SoyBase N/A ISS
GO:0043085 GO-bp
Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity
SoyBase N/A ISS
GO:0045454 GO-bp
Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0005829 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosol
SoyBase N/A ISS
GO:0048046 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: apoplast
SoyBase N/A ISS
GO:0008047 GO-mf
Annotation by Michelle Graham. GO Molecular Function: iron-sulfur cluster assembly
SoyBase N/A ISS
GO:0009055 GO-mf
Annotation by Michelle Graham. GO Molecular Function: electron carrier activity
SoyBase N/A ISS
GO:0015035 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity
SoyBase N/A ISS
GO:0016671 GO-mf
Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor
SoyBase N/A ISS
KOG0907
KOG
Thioredoxin
JGI ISS
PTHR10438 Panther
THIOREDOXIN-RELATED
JGI ISS
PF00085 PFAM
Thioredoxin
JGI ISS
UniRef100_I1JT75 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Thioredoxin n=1 Tax=Glycine max RepID=I1JT75_SOYBN
SoyBase E_val: 3.00E-77 ISS
UniRef100_I1JT75 UniRef
Annotation by Michelle Graham. Best UniRef hit: Thioredoxin n=1 Tax=Glycine max RepID=I1JT75_SOYBN
SoyBase E_val: 3.00E-77 ISS
Expression Patterns of Glyma04g03110
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma04g03110
Paralog Evidence Comments
Glyma06g03150 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g03110 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g028500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g03110
Coding sequences of Glyma04g03110
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g03110.1 sequence type=CDS gene model=Glyma04g03110 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCCGAAGAGGGACAAGTGATTGGTGTCCACAGCGTGGAGGAGTGGGAGGAACATCTCAAGAAGGGACAAGAGTCCAAGAAATTGATTGTGGTGGATTTTACTGCTTCTTGGTGCGGCCCATGCCGTTTCATTGCCCCAATTCTTGCGGATATGGCTAAAAAGTTGCCGAATGTCACCTTCCTCAAGGTGGATGTGGATGAATTGGCGACTGTTTCCAGGGAGTGGGAAGTTGAGGCTATGCCAACCTTCCTATTCTTGAAAGAAGGCAAGCTGGTGAAGAAGCTTGTGGGTGCCAGGAAAGAGGAGCTGCAAGACATAATAGTCAAACTTGCTGCAATTGATGCTGCCTGA
Predicted protein sequences of Glyma04g03110
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g03110.1 sequence type=predicted peptide gene model=Glyma04g03110 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAEEGQVIGVHSVEEWEEHLKKGQESKKLIVVDFTASWCGPCRFIAPILADMAKKLPNVTFLKVDVDELATVSREWEVEAMPTFLFLKEGKLVKKLVGARKEELQDIIVKLAAIDAA*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
