SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g03020

Feature Type:gene_model
Chromosome:Gm04
Start:2195154
stop:2196970
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g03020
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G39090AT Annotation by Michelle Graham. TAIR10: Papain family cysteine protease | chr4:18215826-18217326 REVERSE LENGTH=368 SoyBaseE_val: 0ISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009269GO-bp Annotation by Michelle Graham. GO Biological Process: response to desiccation SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0004197GO-mf Annotation by Michelle Graham. GO Molecular Function: cysteine-type endopeptidase activity SoyBaseN/AISS
GO:0008234GO-mf Annotation by Michelle Graham. GO Molecular Function: cysteine-type peptidase activity SoyBaseN/AISS
KOG1542 KOG Cysteine proteinase Cathepsin F JGI ISS
PTHR12411Panther CYSTEINE PROTEASE FAMILY C1-RELATED JGI ISS
PTHR12411:SF42Panther CATHEPSIN-W-RELATED JGI ISS
PF00112PFAM Papain family cysteine protease JGI ISS
PF08246PFAM Cathepsin propeptide inhibitor domain (I29) JGI ISS
UniRef100_B7UCQ3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cysteine protease-like protein n=1 Tax=Arachis hypogaea RepID=B7UCQ3_ARAHY SoyBaseE_val: 0ISS
UniRef100_I1JT65UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JT65_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma04g03020
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g03020
ParalogEvidenceComments
Glyma06g03050 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g03020 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g027600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g03020
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g03020
>Glyma04g03020.1   sequence type=CDS   gene model=Glyma04g03020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTAATCTCTCAATCTTGTTCTTCGGTCTCCTCCTATTCTCCGCTGCCGTAGCCACCGTCGAACGAATCGACGATGAAGACAACCTTCTGATCCGTCAAGTGGTGCCGGACGCGGAGGACCACCACCTGCTCAACGCGGAGCACCACTTCTCCGCCTTCAAGACAAAGTTCGCCAAGACCTACGCCACGCAGGAGGAGCACGACCACCGCTTCCGTATCTTCAAGAACAACTTGCTCCGCGCCAAGTCGCACCAGAAATTGGACCCCTCCGCCGTCCACGGCGTCACCAGGTTCTCCGATCTCACTCCGTCTGAGTTTCGCGGCCAGTTCCTCGGCCTGAAGCCGCTCCGCCTTCCCTCCGACGCTCAGAAGGCTCCGATCCTTCCGACCAGCGACCTTCCTACCGATTTCGATTGGCGCGACCATGGAGCTGTTACCGGCGTCAAGAATCAGGGCTCGTGCGGATCGTGTTGGTCATTTAGCGCCGTTGGAGCTTTGGAAGGTGCCCATTTTCTTTCTACCGGTGGGCTCGTGAGCCTCAGTGAGCAGCAACTTGTGGATTGCGATCATGAGTGTGATCCGGAAGAGCGTGGAGCATGTGATTCGGGTTGTAACGGTGGGTTGATGACCACTGCATTTGAGTACACACTCAAGGCTGGTGGACTAATGCGAGAAGAGGATTATCCCTACACTGGAAGAGACCGTGGCCCCTGCAAATTTGACAAGAGCAAAATCGCTGCTTCCGTGGCTAATTTCAGTGTGGTTTCCCTTGATGAAGAACAAATTGCTGCAAATCTGGTCAAGAATGGTCCTCTTGCAGTTGGTATCAATGCAGTTTTTATGCAGACATATATTGGTGGCGTCTCATGCCCATACATCTGCGGCAAGCATTTGGATCATGGGGTTCTTTTGGTGGGCTATGGATCTGGTGCTTATGCTCCAATTCGTTTTAAGGAAAAGCCTTACTGGATCATAAAGAATTCATGGGGGGAGAGCTGGGGAGAAGAAGGATATTACAAGATCTGCAGAGGTCGCAATGTATGTGGGGTGGACTCGATGGTCTCAACTGTAGCTGCTATACATGTTTCTAACCATTAA
Predicted protein sequences of Glyma04g03020
>Glyma04g03020.1   sequence type=predicted peptide   gene model=Glyma04g03020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MANLSILFFGLLLFSAAVATVERIDDEDNLLIRQVVPDAEDHHLLNAEHHFSAFKTKFAKTYATQEEHDHRFRIFKNNLLRAKSHQKLDPSAVHGVTRFSDLTPSEFRGQFLGLKPLRLPSDAQKAPILPTSDLPTDFDWRDHGAVTGVKNQGSCGSCWSFSAVGALEGAHFLSTGGLVSLSEQQLVDCDHECDPEERGACDSGCNGGLMTTAFEYTLKAGGLMREEDYPYTGRDRGPCKFDKSKIAASVANFSVVSLDEEQIAANLVKNGPLAVGINAVFMQTYIGGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTVAAIHVSNH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo