SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g02980): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g02980): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g02980

Feature Type:gene_model
Chromosome:Gm04
Start:2155604
stop:2159914
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G54340AT Annotation by Michelle Graham. TAIR10: K-box region and MADS-box transcription factor family protein | chr3:20119428-20121087 REVERSE LENGTH=232 SoyBaseE_val: 4.00E-91ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009827GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0009886GO-bp Annotation by Michelle Graham. GO Biological Process: post-embryonic morphogenesis SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0010093GO-bp Annotation by Michelle Graham. GO Biological Process: specification of floral organ identity SoyBaseN/AISS
GO:0048440GO-bp Annotation by Michelle Graham. GO Biological Process: carpel development SoyBaseN/AISS
GO:0048441GO-bp Annotation by Michelle Graham. GO Biological Process: petal development SoyBaseN/AISS
GO:0048443GO-bp Annotation by Michelle Graham. GO Biological Process: stamen development SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0048507GO-bp Annotation by Michelle Graham. GO Biological Process: meristem development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
KOG0014 KOG MADS box transcription factor JGI ISS
PTHR11945Panther MADS BOX PROTEIN JGI ISS
PTHR11945:SF76Panther SUBFAMILY NOT NAMED JGI ISS
PF00319PFAM SRF-type transcription factor (DNA-binding and dimerisation domain) JGI ISS
PF01486PFAM K-box region JGI ISS
UniRef100_I1JT61UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JT61_SOYBN SoyBaseE_val: 1.00E-168ISS
UniRef100_Q5VKS3UniRef Annotation by Michelle Graham. Most informative UniRef hit: MADS-box protein GmNMH7 n=2 Tax=Glycine max RepID=Q5VKS3_SOYBN SoyBaseE_val: 5.00E-162ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g02980 not represented in the dataset

Glyma04g02980 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g02990 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g027200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g02980.1   sequence type=CDS   gene model=Glyma04g02980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTAGAGGAAAGATCCAGATCAAGAGGATAGAGAACAACACCAACCGCCAGGTCACTTACTCTAAACGACGGAATGGCCTTTTCAAGAAGGCCAACGAGCTTACCGTTCTCTGCGATGCCAAGGTTTCTATTATTATGTTCTCCAGCACTGGAAAACTCCACCAGTACATCAGCCCCTCCACCTCAACAAAGCAGTTCTTCGATCAATACCAGATGACTCTGGGAGTTGATCTCTGGAACTCTCATTACGAGAATATGCAAGAGAACTTGAAGAAACTGAAAGAGGTGAATAGGAATCTTCGTAAGGAGATTAGGCAGAGAATGGGAGATTGTCTGAACGAGCTGGGCATGGAAGATCTCAAGCTCCTTGAGGAAGAAATGGACAAGGCCGCCAAGGTTGTTCGTGAGCGTAAGTATAAGGTGATAACAAATCAGATTGACACCCAGAGGAAAAAGTTTAATAACGAGAAAGAAGTGCACAACAGGCTCCTGCATGACTTGGATGCAAAAGCAGAAGATCCACGTTTTGCATTGATAGATAATGGAGGGGAGTATGAGTCTGTGATCGGATTCTCAAATTTAGGTCCACGCATGTTCGCATTGAGCATACAACCAAGCCATCCTAGTGCCCATAGCGGAGGAGCAGGCTCTGATCTTACCACTTACCCTTTACTTTTCTAG

>Glyma04g02980.1   sequence type=predicted peptide   gene model=Glyma04g02980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MARGKIQIKRIENNTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHQYISPSTSTKQFFDQYQMTLGVDLWNSHYENMQENLKKLKEVNRNLRKEIRQRMGDCLNELGMEDLKLLEEEMDKAAKVVRERKYKVITNQIDTQRKKFNNEKEVHNRLLHDLDAKAEDPRFALIDNGGEYESVIGFSNLGPRMFALSIQPSHPSAHSGGAGSDLTTYPLLF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo