SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g02660

Feature Type:gene_model
Chromosome:Gm04
Start:1890702
stop:1892010
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g02660
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G75750AT Annotation by Michelle Graham. TAIR10: GAST1 protein homolog 1 | chr1:28441813-28442284 REVERSE LENGTH=97 SoyBaseE_val: 2.00E-31ISS
GO:0000271GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process SoyBaseN/AISS
GO:0006569GO-bp Annotation by Michelle Graham. GO Biological Process: tryptophan catabolic process SoyBaseN/AISS
GO:0009684GO-bp Annotation by Michelle Graham. GO Biological Process: indoleacetic acid biosynthetic process SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009739GO-bp Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus SoyBaseN/AISS
GO:0009741GO-bp Annotation by Michelle Graham. GO Biological Process: response to brassinosteroid stimulus SoyBaseN/AISS
GO:0009825GO-bp Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth SoyBaseN/AISS
GO:0009826GO-bp Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth SoyBaseN/AISS
GO:0009932GO-bp Annotation by Michelle Graham. GO Biological Process: cell tip growth SoyBaseN/AISS
GO:0010817GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF02704PFAM Gibberellin regulated protein JGI ISS
UniRef100_C6TBK8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TBK8_SOYBN SoyBaseE_val: 2.00E-65ISS
UniRef100_G7I774UniRef Annotation by Michelle Graham. Most informative UniRef hit: Gibberellin-regulated protein n=1 Tax=Medicago truncatula RepID=G7I774_MEDTR SoyBaseE_val: 3.00E-49ISS

Expression Patterns of Glyma04g02660
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g02660
ParalogEvidenceComments
Glyma06g02690 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g02660 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g024400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g02660
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g02660
>Glyma04g02660.1   sequence type=CDS   gene model=Glyma04g02660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCTCTCAAAGCTTCTAGTTGCATCCCTTCTGGTATCCTTTGTCCTCTTCCATCTCGTTGATGCTGATGATCAATCGGCATACGCACAGACTCAGGGTTCTCTTGTTCAGCAGATAGATTGTAATGCTGCATGTGCTGCGAGGTGCCGTTTAGCATCTCGTCAGCGCATGTGCCACAGAGCGTGTGGAACTTGCTGCAGACGCTGCAACTGCGTGCCACCGGGAACTTCCGGTAACCAAGAAGTGTGTCCCTGTTATGCCAGTCTCAGAACCCACGGGGGCAGACGCAAGTGCCCTTAA
Predicted protein sequences of Glyma04g02660
>Glyma04g02660.1   sequence type=predicted peptide   gene model=Glyma04g02660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALSKLLVASLLVSFVLFHLVDADDQSAYAQTQGSLVQQIDCNAACAARCRLASRQRMCHRACGTCCRRCNCVPPGTSGNQEVCPCYASLRTHGGRRKCP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo