Glyma04g02610 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g02610

Feature Type:	gene_model
Chromosome:	Gm04
Start:	1862583
stop:	1866246
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g02610

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G75780	AT	Annotation by Michelle Graham. TAIR10: tubulin beta-1 chain \| chr1:28451378-28453602 REVERSE LENGTH=447	SoyBase	E_val: 0	ISS
GO:0000271	GO-bp	Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process	SoyBase	N/A	ISS
GO:0006094	GO-bp	Annotation by Michelle Graham. GO Biological Process: gluconeogenesis	SoyBase	N/A	ISS
GO:0006184	GO-bp	Annotation by Michelle Graham. GO Biological Process: GTP catabolic process	SoyBase	N/A	ISS
GO:0007010	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization	SoyBase	N/A	ISS
GO:0007017	GO-bp	Annotation by Michelle Graham. GO Biological Process: microtubule-based process	SoyBase	N/A	ISS
GO:0007018	GO-bp	Annotation by Michelle Graham. GO Biological Process: microtubule-based movement	SoyBase	N/A	ISS
GO:0009416	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to light stimulus	SoyBase	N/A	ISS
GO:0009825	GO-bp	Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth	SoyBase	N/A	ISS
GO:0009826	GO-bp	Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth	SoyBase	N/A	ISS
GO:0009932	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell tip growth	SoyBase	N/A	ISS
GO:0010498	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process	SoyBase	N/A	ISS
GO:0010817	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels	SoyBase	N/A	ISS
GO:0043481	GO-bp	Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light	SoyBase	N/A	ISS
GO:0048767	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair elongation	SoyBase	N/A	ISS
GO:0051258	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein polymerization	SoyBase	N/A	ISS
GO:0071555	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall organization	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005874	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: microtubule	SoyBase	N/A	ISS
GO:0003924	GO-mf	Annotation by Michelle Graham. GO Molecular Function: GTPase activity	SoyBase	N/A	ISS
GO:0005198	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural molecule activity	SoyBase	N/A	ISS
GO:0005525	GO-mf	Annotation by Michelle Graham. GO Molecular Function: GTP binding	SoyBase	N/A	ISS
KOG1375	KOG	Beta tubulin	JGI		ISS
PTHR11588	Panther	TUBULIN	JGI		ISS
PF00091	PFAM	Tubulin/FtsZ family, GTPase domain	JGI		ISS
PF03953	PFAM	Tubulin C-terminal domain	JGI		ISS
UniRef100_B9R897	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Tubulin beta chain, putative n=1 Tax=Ricinus communis RepID=B9R897_RICCO	SoyBase	E_val: 0	ISS
UniRef100_I1JT28	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JT28_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma04g02610

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g02610

Paralog	Evidence	Comments
Glyma06g02650	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g02610 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g023900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g02610

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g02610

Limit To All Plant Sequences

>Glyma04g02610.1   sequence type=CDS   gene model=Glyma04g02610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGAGAGATCTTGCACGTTCAGGGAGGCCAATGCGGTAACCAAATCGGTTCCAAGTTCTGGGAGGTGATCTGCGACGAGCACGGCATCGATCCCACCGGAAAGTACAACGAGGAAGGCAACAGCAGCATCCAACTCGAAAGGATCAATGTGTATTACAACGAGGCCTCTGGCGGAAGGTACGTTCCCCGTGCCGTGCTTATGGATCTCGAACCTGGAACCATGGACAGCATCAGATCTGGCCCCTACGGCAAGATCTTCCGCCCCGACAACTTCGTCTTCGGCCAGTCCGGCGCCGGTAACAATTGGGCCAAAGGTCATTATACTGAAGGCGCCGAGCTGATCGACTCCGTTCTCGACGTCGTTCGCAAAGAGGCTGAAAACTGCGATTGCTTGCAAGGTTTTCAAGTTTGCCACTCTCTTGGAGGAGGCACAGGTTCTGGCATGGGAACACTGTTGATATCAAAAATTAGGGAGGAATACCCAGACAGAATGATGCTCACTTTCTCTGTTTTCCCATCTCCAAAAGTTTCTGATACAGTTGTGGAGCCATACAATGCCACTTTGTCTGTACACCAACTGGTTGAAAATGCAGATGAGTGCATGGTTCTTGACAATGAAGCACTTTATGACATTTGCTTTAGGACATTGAAACTCAGCACCCCTAGCTTTGGTGATCTCAACCATCTGATTTCTGCAACCATGAGTGGGGTTACCTGTTGTCTGAGGTTTCCTGGACAACTGAACTCTGACCTCAGGAAGCTGGCTGTCAATCTGATTCCATTTCCCCGTCTTCACTTCTTTATGGTGGGGTTTGCACCTCTCACTTCTCGTGGGTCTCAGCAATATGTCTCCCTTACTGTCCCAGAGCTGACTCAGCAAATGTGGGATGCCAAAAATATGATGTGTGCTGCTGATCCCCGACACGGCCGATACTTGACTGCATCTGCTATGTTCAGGGGAAAGATGAGCACCAAAGAGGTTGATGAACAAATGATCAATGTGCAGAACAAAAACTCGTCATACTTTGTTGAATGGATTCCCAACAATGTGAAGTCCAGCGTTTGTGATATTCCACCCAGGAATTTGAAGATGTCATCCACATTTATTGGCAACTCAACATCGATTCAAGAGATGTTTAGGAGGGTCAGCGAGCAGTTCACTGCTATGTACCGGCGCAAAGCCTTCTTGCACTGGTACACTGGGGAGGGGATGGACGAGATGGAGTTCACCGAGGCAGAGAGTAATATGAATGATTTGGTAGCAGAGTACCAGCAGTACCAGGATGCAACAGCAGAGGAGGATGAATACGAGGATGACGGTGATGAGCAGCAGTATGATGACCAGTAG

Predicted protein sequences of Glyma04g02610

Limit To All Plant Sequences

>Glyma04g02610.1   sequence type=predicted peptide   gene model=Glyma04g02610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MREILHVQGGQCGNQIGSKFWEVICDEHGIDPTGKYNEEGNSSIQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGKIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPSFGDLNHLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYVSLTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRNLKMSSTFIGNSTSIQEMFRRVSEQFTAMYRRKAFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQDATAEEDEYEDDGDEQQYDDQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain