Report for Sequence Feature Glyma04g02360
Feature Type: gene_model
Chromosome: Gm04
Start: 1638468
stop: 1641656
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g02360
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G76020 AT
Annotation by Michelle Graham. TAIR10: Thioredoxin superfamily protein | chr1:28532243-28533542 REVERSE LENGTH=225
SoyBase E_val: 2.00E-81 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005618 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cell wall
SoyBase N/A ISS
GO:0005773 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: vacuole
SoyBase N/A ISS
UniRef100_C6T172 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T172_SOYBN
SoyBase E_val: 2.00E-173 ISS
UniRef100_Q9LNU5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: T20H2.2 protein n=2 Tax=Arabidopsis thaliana RepID=Q9LNU5_ARATH
SoyBase E_val: 4.00E-75 ISS
Expression Patterns of Glyma04g02360
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma04g02360
Paralog Evidence Comments
Glyma06g02400 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g02360 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g021400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g02360
Coding sequences of Glyma04g02360
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g02360.1 sequence type=CDS gene model=Glyma04g02360 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAAGATGTTGCGAACGACAATACTGCAATTCGCTGCGTTGCAGGTTTTGTTTATTCTGTTGGGTGTTGGTGCCGATTACATACCGCCTTCGAGATTTGATGGCTTCGTCTACGGGAAGGGGAACTTGAATTTGTTGGATACGGTTTTGATAGAAGCGTTTTATGACCCAGTGTGCCCAGATAGCAGGGATTCCTGGCCTCCACTCAAACAAGCTCTTCATCACTACGCTTCTCGGGTTTCGCTCCTTCTTCACCTCCTCCCTCTACCTTACCATGACAATGCTTTTGTTACGTCTCGTGCTCTGCACATTGTGAACAATTTGAACGCATCTGCAACGTTCCCCTTGCTGGAGTGGTTCTTCAGGTATCAGGAGAATTTCTATGGGGCTCAAACACGGAACTTATCTAGGGCTTCTATTATAGAGGAAGTAGTGAAGTCTGCAACACAAGTAGTTGGGAGCTCTTATTATAAAACCATAAAGAATGGCTTCAATGACACAACAACTGATATTCAGACCAGAGTTTCTTTTAAGTATGCTGCTTCGAGAGGGGTGTATGGAACGCCATTTTTCTATGTCAATGGATTCTTGTTGCCTGATACTGGAGCTGCTGTTGACTACAAGACTTGGAGAAAGGTCATTGACCCATTGGTTGGTGCTAAGAATAAGAAGAGTATCCAAAATGAAGAGTCCCTTCATTTCTTCTTGTGA
Predicted protein sequences of Glyma04g02360
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g02360.1 sequence type=predicted peptide gene model=Glyma04g02360 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MKMLRTTILQFAALQVLFILLGVGADYIPPSRFDGFVYGKGNLNLLDTVLIEAFYDPVCPDSRDSWPPLKQALHHYASRVSLLLHLLPLPYHDNAFVTSRALHIVNNLNASATFPLLEWFFRYQENFYGAQTRNLSRASIIEEVVKSATQVVGSSYYKTIKNGFNDTTTDIQTRVSFKYAASRGVYGTPFFYVNGFLLPDTGAAVDYKTWRKVIDPLVGAKNKKSIQNEESLHFFL*