SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g02351

Feature Type:gene_model
Chromosome:Gm04
Start:1631500
stop:1634802
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g02351
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G76020AT Annotation by Michelle Graham. TAIR10: Thioredoxin superfamily protein | chr1:28532243-28533542 REVERSE LENGTH=225 SoyBaseE_val: 4.00E-83ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
UniRef100_I1JSZ7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JSZ7_SOYBN SoyBaseE_val: 2.00E-171ISS
UniRef100_Q9LNU5UniRef Annotation by Michelle Graham. Most informative UniRef hit: T20H2.2 protein n=2 Tax=Arabidopsis thaliana RepID=Q9LNU5_ARATH SoyBaseE_val: 1.00E-76ISS

Expression Patterns of Glyma04g02351
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g02351 not represented in the dataset
Glyma04g02351 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g02351 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g021300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g02351
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g02351
>Glyma04g02351.1   sequence type=CDS   gene model=Glyma04g02351   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAATGTTGCAGGTGGCAATAGTGCAATTGGCTGCGTTGCAGGTTTTTGTTATTTTTTTGAGTGGTGGTGCTGATTACATACCGCCTTCAAGGTTGGATGGGTTCGTCTACCAAAATGGGTACTTAGATTTGGATACTGTTTTGATAGAAGCGTTTTATGATCCGGTGTGCCCATACAGCAGGGATTCATGGCCTCCACTCAAACAAGCTCTTCATCACTATTCTTCTCGGGTTTCGTTCCTCCTTCATCTCCTCCCTTTACCTTACCATGACAATGCTTTCGTCGCGACCCGTGCTTTGCACATTGTGAACACATTGAACGCATCTGCAACGTTCCCCTTGCTGGAATGGTTCTTCAAGCATCAGGAGAAATTTTACGGGGCCCAAACACGGAACTTATCTAGGGCTTCTATTGTAGATGAGATAGTGAAGTCTGCAACAGAAGCAGCTGGGAGCTCTTATTATAACGCCATAAAGCATGGCTTCAATGACACAAAAACTGATTATCAGACCAGAGTTTCTTTCAAGTACGCTGCTTCGAGAGGGGTGTATGGAACGCCTTCTTTCTATGTCAATGGATTCTTGTTGCCTGATACTGGAGCTACCGCTGACTACAAGACTTGGAGGAAGGTCATTGATCCATTGGTTGGTGTGAAGAAGAGTATCCAGAATGAAGAGTCCCTTCGTTTCTTCTTGTAA
Predicted protein sequences of Glyma04g02351
>Glyma04g02351.1   sequence type=predicted peptide   gene model=Glyma04g02351   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKMLQVAIVQLAALQVFVIFLSGGADYIPPSRLDGFVYQNGYLDLDTVLIEAFYDPVCPYSRDSWPPLKQALHHYSSRVSFLLHLLPLPYHDNAFVATRALHIVNTLNASATFPLLEWFFKHQEKFYGAQTRNLSRASIVDEIVKSATEAAGSSYYNAIKHGFNDTKTDYQTRVSFKYAASRGVYGTPSFYVNGFLLPDTGATADYKTWRKVIDPLVGVKKSIQNEESLRFFL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo