Report for Sequence Feature Glyma04g02300
Feature Type: gene_model
Chromosome: Gm04
Start: 1588821
stop: 1593552
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g02300
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G20270 AT
Annotation by Michelle Graham. TAIR10: 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein | chr1:7021383-7022923 REVERSE LENGTH=287
SoyBase E_val: 4.00E-167 ISS
GO:0018401 GO-bp
Annotation by Michelle Graham. GO Biological Process: peptidyl-proline hydroxylation to 4-hydroxy-L-proline
SoyBase N/A ISS
GO:0055114 GO-bp
Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0005768 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: endosome
SoyBase N/A ISS
GO:0005794 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus
SoyBase N/A ISS
GO:0005802 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network
SoyBase N/A ISS
GO:0005506 GO-mf
Annotation by Michelle Graham. GO Molecular Function: iron ion binding
SoyBase N/A ISS
GO:0016491 GO-mf
Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity
SoyBase N/A ISS
GO:0016705 GO-mf
Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
SoyBase N/A ISS
GO:0016706 GO-mf
Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors
SoyBase N/A ISS
GO:0031418 GO-mf
Annotation by Michelle Graham. GO Molecular Function: L-ascorbic acid binding
SoyBase N/A ISS
KOG1591
KOG
Prolyl 4-hydroxylase alpha subunit
JGI ISS
PTHR10869 Panther
PROLYL 4-HYDROXYLASE ALPHA SUBUNIT
JGI ISS
PF03171 PFAM
2OG-Fe(II) oxygenase superfamily
JGI ISS
UniRef100_G7J5W0 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Prolyl 4-hydroxylase alpha-2 subunit n=2 Tax=Medicago truncatula RepID=G7J5W0_MEDTR
SoyBase E_val: 2.00E-171 ISS
UniRef100_I1JSZ3 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JSZ3_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma04g02300
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma04g02300
Paralog Evidence Comments
Glyma06g02360 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g02300 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g020800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g02300
Coding sequences of Glyma04g02300
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g02300.1 sequence type=CDS gene model=Glyma04g02300 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCGAAAGGAAAGCATTCGCATACCCGCGCACAAGGGAAGAAGTGGTCAACGTTCTCGCTGGTTCTGTGGGCGCTTTTCTTCCTCACACTCATCCTCGTCGTGCTCCTTGCTCTCGGCATTGTTTATCTTCCAACCACCGACGACGATTTTCCAACCACGGAGCTCAGCGCCTTCAGGCGCAAGACCTCTCAAAGTGGCGAGAGTTTGGTGGAAAACTCGGAGCAGTGGACCGAGATTCTCTCCTGGGAGCCAAGAGCGTTCATCTATCACAATTTTCTGTCTAAAGAAGAATGTGAGTACTTGATTGAACTTGCCAAACCTCATATGGTAAAATCAAGTGTTGTTGATAGCAAGACTGGGAAGAGTACAGAAAGCAGGGTTCGAACCAGTTCAGGAATGTTCTTGAAGAGAGGAAGGGACAAAATCATCCAGAATATAGAGAAAAGAATTGCTGACTTTACCTTCATACCTGTAGAGAATGGAGAAGGACTTCAAATCCTTCACTATGAAGCAGGACAAAAATATGAGCCTCACTATGATTACTTCCTTGATGAGTTCAACACTAAGAATGGAGGCCAACGTATTGCTACAGTTCTTATGTACCTTTCAGATGTTGAAGAAGGCGGTGAGACTGTATTTCCTGCTGCCAATGCAAATTTTAGTTCTGTGCCTTGGTGGAATGATTTATCCCAATGTGCAAGAAAGGGTCTCTCAGTGAAACCAAAAATGGGTGATGCTCTGCTATTTTGGAGCATGAGGCCTGATGCCACTCTAGATCCATCTAGTTTACATGGCGGTTGCCCAGTAATTAAAGGAAATAAATGGTCTTCAACAAAGTGGCTGCATCTTCATGAGTACAAGGTTTGA
Predicted protein sequences of Glyma04g02300
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g02300.1 sequence type=predicted peptide gene model=Glyma04g02300 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAKGKHSHTRAQGKKWSTFSLVLWALFFLTLILVVLLALGIVYLPTTDDDFPTTELSAFRRKTSQSGESLVENSEQWTEILSWEPRAFIYHNFLSKEECEYLIELAKPHMVKSSVVDSKTGKSTESRVRTSSGMFLKRGRDKIIQNIEKRIADFTFIPVENGEGLQILHYEAGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVEEGGETVFPAANANFSSVPWWNDLSQCARKGLSVKPKMGDALLFWSMRPDATLDPSSLHGGCPVIKGNKWSSTKWLHLHEYKV*