SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma04g02240

Feature Type:gene_model
Chromosome:Gm04
Start:1552511
stop:1553784
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G20340AT Annotation by Michelle Graham. TAIR10: Cupredoxin superfamily protein | chr1:7042770-7043273 REVERSE LENGTH=167 SoyBaseE_val: 2.00E-75ISS
GO:0000271GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process SoyBaseN/AISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006417GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of translation SoyBaseN/AISS
GO:0009411GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV SoyBaseN/AISS
GO:0009637GO-bp Annotation by Michelle Graham. GO Biological Process: response to blue light SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0009657GO-bp Annotation by Michelle Graham. GO Biological Process: plastid organization SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009825GO-bp Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth SoyBaseN/AISS
GO:0009932GO-bp Annotation by Michelle Graham. GO Biological Process: cell tip growth SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0010114GO-bp Annotation by Michelle Graham. GO Biological Process: response to red light SoyBaseN/AISS
GO:0010155GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of proton transport SoyBaseN/AISS
GO:0010218GO-bp Annotation by Michelle Graham. GO Biological Process: response to far red light SoyBaseN/AISS
GO:0010817GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels SoyBaseN/AISS
GO:0017148GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of translation SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0042744GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide catabolic process SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0046688GO-bp Annotation by Michelle Graham. GO Biological Process: response to copper ion SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0055070GO-bp Annotation by Michelle Graham. GO Biological Process: copper ion homeostasis SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009543GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0031977GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
PF00127PFAM Copper binding proteins, plastocyanin/azurin family JGI ISS
UniRef100_B9R8G0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Plastocyanin A, chloroplast, putative n=1 Tax=Ricinus communis RepID=B9R8G0_RICCO SoyBaseE_val: 2.00E-91ISS
UniRef100_I1JSY7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JSY7_SOYBN SoyBaseE_val: 1.00E-111ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g02300 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g020300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g02240.1   sequence type=CDS   gene model=Glyma04g02240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCACCGTCACTTCTGCAGCCGTTGCTATTCCCTCATTCACTGGCCTCAAGGCAAGCGCAGGCAAAGTGAGTGCCGCAGTTAAAGTCTCAGCTCCCCAAGCCACAAGGTTGGGCATCAAGGCTTCGCTGAAAGACGTTGGAGTCGCTGTTGTGGCCACTGCCGCGAGTGCAGTGCTGGCTAGCAACGCCATGGCCATTGAAGTGTTGCTGGGTGGTGATGACGGGTCTCTGGCTTTCGTTCCCAACAATTTCTCCGTGGCCTCTGGGGAGAAGATCGTGTTCAAGAACAACGCAGGTTTCCCCCACAACGTTGTGTTCGACGAGGACGAGATTCCTAGCGGCGTGGATGCAGGGAAAATCTCCATGAGCGATGAAGACCTTCTCAATGCGCCTGGTGAGACTTACAGCGTTACTTTGGATGCTAAGGGAACCTACAGTTTCTTCTGTTCGCCTCACCAAGGAGCTGGTATGGTGGGAAAAGTCACTGTTAATTAA

>Glyma04g02240.1   sequence type=predicted peptide   gene model=Glyma04g02240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATVTSAAVAIPSFTGLKASAGKVSAAVKVSAPQATRLGIKASLKDVGVAVVATAASAVLASNAMAIEVLLGGDDGSLAFVPNNFSVASGEKIVFKNNAGFPHNVVFDEDEIPSGVDAGKISMSDEDLLNAPGETYSVTLDAKGTYSFFCSPHQGAGMVGKVTVN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo