Glyma04g02240 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g02240

Feature Type:	gene_model
Chromosome:	Gm04
Start:	1552511
stop:	1553784
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g02240

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G20340	AT	Annotation by Michelle Graham. TAIR10: Cupredoxin superfamily protein \| chr1:7042770-7043273 REVERSE LENGTH=167	SoyBase	E_val: 2.00E-75	ISS
GO:0000271	GO-bp	Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process	SoyBase	N/A	ISS
GO:0006098	GO-bp	Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt	SoyBase	N/A	ISS
GO:0006417	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of translation	SoyBase	N/A	ISS
GO:0009411	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to UV	SoyBase	N/A	ISS
GO:0009637	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to blue light	SoyBase	N/A	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0009657	GO-bp	Annotation by Michelle Graham. GO Biological Process: plastid organization	SoyBase	N/A	ISS
GO:0009744	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus	SoyBase	N/A	ISS
GO:0009825	GO-bp	Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth	SoyBase	N/A	ISS
GO:0009932	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell tip growth	SoyBase	N/A	ISS
GO:0009965	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis	SoyBase	N/A	ISS
GO:0010114	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to red light	SoyBase	N/A	ISS
GO:0010155	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of proton transport	SoyBase	N/A	ISS
GO:0010218	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to far red light	SoyBase	N/A	ISS
GO:0010817	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels	SoyBase	N/A	ISS
GO:0017148	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of translation	SoyBase	N/A	ISS
GO:0019344	GO-bp	Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process	SoyBase	N/A	ISS
GO:0030154	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell differentiation	SoyBase	N/A	ISS
GO:0042744	GO-bp	Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide catabolic process	SoyBase	N/A	ISS
GO:0043481	GO-bp	Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0046688	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to copper ion	SoyBase	N/A	ISS
GO:0048767	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair elongation	SoyBase	N/A	ISS
GO:0055070	GO-bp	Annotation by Michelle Graham. GO Biological Process: copper ion homeostasis	SoyBase	N/A	ISS
GO:0071555	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall organization	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009543	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0009579	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid	SoyBase	N/A	ISS
GO:0031977	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
PF00127	PFAM	Copper binding proteins, plastocyanin/azurin family	JGI		ISS
UniRef100_B9R8G0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Plastocyanin A, chloroplast, putative n=1 Tax=Ricinus communis RepID=B9R8G0_RICCO	SoyBase	E_val: 2.00E-91	ISS
UniRef100_I1JSY7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JSY7_SOYBN	SoyBase	E_val: 1.00E-111	ISS

Expression Patterns of Glyma04g02240

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g02240

Paralog	Evidence	Comments
Glyma06g02300	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g02240 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g020300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g02240

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g02240

Limit To All Plant Sequences

>Glyma04g02240.1   sequence type=CDS   gene model=Glyma04g02240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCACCGTCACTTCTGCAGCCGTTGCTATTCCCTCATTCACTGGCCTCAAGGCAAGCGCAGGCAAAGTGAGTGCCGCAGTTAAAGTCTCAGCTCCCCAAGCCACAAGGTTGGGCATCAAGGCTTCGCTGAAAGACGTTGGAGTCGCTGTTGTGGCCACTGCCGCGAGTGCAGTGCTGGCTAGCAACGCCATGGCCATTGAAGTGTTGCTGGGTGGTGATGACGGGTCTCTGGCTTTCGTTCCCAACAATTTCTCCGTGGCCTCTGGGGAGAAGATCGTGTTCAAGAACAACGCAGGTTTCCCCCACAACGTTGTGTTCGACGAGGACGAGATTCCTAGCGGCGTGGATGCAGGGAAAATCTCCATGAGCGATGAAGACCTTCTCAATGCGCCTGGTGAGACTTACAGCGTTACTTTGGATGCTAAGGGAACCTACAGTTTCTTCTGTTCGCCTCACCAAGGAGCTGGTATGGTGGGAAAAGTCACTGTTAATTAA

Predicted protein sequences of Glyma04g02240

Limit To All Plant Sequences

>Glyma04g02240.1   sequence type=predicted peptide   gene model=Glyma04g02240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATVTSAAVAIPSFTGLKASAGKVSAAVKVSAPQATRLGIKASLKDVGVAVVATAASAVLASNAMAIEVLLGGDDGSLAFVPNNFSVASGEKIVFKNNAGFPHNVVFDEDEIPSGVDAGKISMSDEDLLNAPGETYSVTLDAKGTYSFFCSPHQGAGMVGKVTVN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain