Glyma04g02230 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g02230

Feature Type:	gene_model
Chromosome:	Gm04
Start:	1548629
stop:	1550214
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g02230

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G11880	AT	Annotation by Michelle Graham. TAIR10: Pyridoxal-dependent decarboxylase family protein \| chr5:3827806-3829942 REVERSE LENGTH=489	SoyBase	E_val: 8.00E-16	ISS
GO:0009089	GO-bp	Annotation by Michelle Graham. GO Biological Process: lysine biosynthetic process via diaminopimelate	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0008836	GO-mf	Annotation by Michelle Graham. GO Molecular Function: diaminopimelate decarboxylase activity	SoyBase	N/A	ISS
KOG0622	KOG	Ornithine decarboxylase	JGI		ISS
PTHR11482	Panther	ARGININE/DIAMINOPIMELATE/ORNITHINE DECARBOXYLASE	JGI		ISS
PTHR11482:SF29	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00278	PFAM	Pyridoxal-dependent decarboxylase, C-terminal sheet domain	JGI		ISS
PF02784	PFAM	Pyridoxal-dependent decarboxylase, pyridoxal binding domain	JGI		ISS
UniRef100_Q70MR6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ornithine decarboxylase n=1 Tax=Glycine max RepID=Q70MR6_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q70MR6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Ornithine decarboxylase n=1 Tax=Glycine max RepID=Q70MR6_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma04g02230

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g02230

Paralog	Evidence	Comments
Glyma06g02290	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g02230 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g020200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g02230

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g02230

Limit To All Plant Sequences

>Glyma04g02230.1   sequence type=CDS   gene model=Glyma04g02230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTTCACTAGTTGCTGAAGCATTCCAAGCCAATGGCGCAGAACCCTTGAACCTGAAGCCCATTTTCTGTGCCTCAGGCATCAAGGGCAAGCGAGTGACTGCGTTGTCAGCAGAAAAAAATGGCCTCACTGATTTCATTCAAAGAATCATTGCTGACAAACCAGACATCGACACACCATTCAGCGTCCTCGATTTGGGGGTCGTCATGGGCCTGATGGACCAATGGGCCTGCAAGCTCCCCACGGTCCAGCCCTTCTACGCCGTCAAGTGCAACCCAAACCTCTCCCTCATCGGTGCGCTCGCTGCGCTCGGCTCCAGCTTCGACTGCGCCAGCAAAGCCGAGATCGAATCCGTTCTCTCCCTCGGAGTCTCACCCGACAGAATCATCTATGCAAACCCATGCAAATCCGAGTCACACATCAGATACGCCGCCTCCGTAGGCGTCAACGTCACAACCTACGACTCCATAGACGAGGTCGAGAAAATCCGAAAATGCCACCCCACGTGCGAGTTGCTCCTCCGCATTAAACCCCCGCAAGACAGCGGAGCGCGAACCAGCTTGGGCCTCAAATACGGCGCGCTTCCCGAGGAAGTCGATGAGCTTCTCCAAGCTGCTCACGAGGCGGGGCTCAAGGTGACCGGCGTGTCCTTCCACATTGGTAGCGGCGGAGCCGACACGCGAGCCTACCACGGAGCCATATCCGCCGCTAAAAACGTCTTCGAATCGGCTTCTCGGCTCGGCTTGCCCAGAATGGGCGTCCTCGACATCGGCGGCGGCTTCACCTCTGGGCCGTCGTTCGAAGCCGCGGCTTTGAAAATAAACGCCGCGATTGAAGGCAGCTTCGGGAAGGAGGAGGGGCTGGTGGTGATTGGCGAGCCGGGTCGTTATTTCGCGGAAACGGCTTTCACGTTGGCGACGAGAGTTATTGGAAAGCGCGTCAGGGGGGACGTGAGGGAGTATTGGATTGACGATGGGATTTACGGAACTCTTAATAACATCGTGTTTGATTACGCTACCGTCACGTGCATGCCACTCGCGTGCACCTCGAAACCGGAGAATCCTACATGCTGCAGGGATTTGAATTTGAAGACTTACCCTAGCACCGTGTTTGGACCCACATGCGATTCTATTGATACGGTTCTGAGGGATTACCAGCTCCCGGAACTGCAAGTGAACGATTGGCTTGTGTTCCCGAACATGGGTGCCTATACGACGTCGTCCGGGACTAACTTCAATGGGTTTAGCTCCTCAGCCAAGTCCATATTCCTTGCATGTTCGAGCCCGGAACACACCATGTTCTAA

Predicted protein sequences of Glyma04g02230

Limit To All Plant Sequences

>Glyma04g02230.1   sequence type=predicted peptide   gene model=Glyma04g02230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPSLVAEAFQANGAEPLNLKPIFCASGIKGKRVTALSAEKNGLTDFIQRIIADKPDIDTPFSVLDLGVVMGLMDQWACKLPTVQPFYAVKCNPNLSLIGALAALGSSFDCASKAEIESVLSLGVSPDRIIYANPCKSESHIRYAASVGVNVTTYDSIDEVEKIRKCHPTCELLLRIKPPQDSGARTSLGLKYGALPEEVDELLQAAHEAGLKVTGVSFHIGSGGADTRAYHGAISAAKNVFESASRLGLPRMGVLDIGGGFTSGPSFEAAALKINAAIEGSFGKEEGLVVIGEPGRYFAETAFTLATRVIGKRVRGDVREYWIDDGIYGTLNNIVFDYATVTCMPLACTSKPENPTCCRDLNLKTYPSTVFGPTCDSIDTVLRDYQLPELQVNDWLVFPNMGAYTTSSGTNFNGFSSSAKSIFLACSSPEHTMF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain