Report for Sequence Feature Glyma04g02130
Feature Type: gene_model
Chromosome: Gm04
Start: 1471917
stop: 1474493
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g02130
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G20430 AT
Annotation by Michelle Graham. TAIR10: unknown protein; Has 29 Blast hits to 29 proteins in 10 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 29; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:7083471-7083821 REVERSE LENGTH=116
SoyBase E_val: 2.00E-30 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_C6T0E1 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T0E1_SOYBN
SoyBase E_val: 4.00E-72 ISS
UniRef100_Q9LMV4 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: F5M15.23 n=1 Tax=Arabidopsis thaliana RepID=Q9LMV4_ARATH
SoyBase E_val: 9.00E-13 ISS
Expression Patterns of Glyma04g02130
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma04g02130
Paralog Evidence Comments
Glyma06g02230 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g02130 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g019400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g02130
Coding sequences of Glyma04g02130
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g02130.1 sequence type=CDS gene model=Glyma04g02130 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTTCTTCTTCAGCTTCTCCTCGACCGAGCGCCGCCGCGGAACATTCGAGGAAGATATTAGGGTTTATGGCGCACGCGAAGCAACGGAAGGACAGCTTCATCCAATTCTTCGCCATGACGGGTATCCTTCTATTGAGCATGCGATCTTTGAGTCAGAAGTACAAAATCCATGGCCTCCAAGAAGACATCCACGCCCTCAGGGTCGACCACGGTTCTCTCACCGACCGCATCAACAACATCAAGAACGACCTCCTTCGAGAAGCTTCTCAAGATTCCACCGGCCTCTTCGCTTCTCGCCTTCGCCACCTCTTTGCAGAACAACACTGA
Predicted protein sequences of Glyma04g02130
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g02130.1 sequence type=predicted peptide gene model=Glyma04g02130 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MASSSASPRPSAAAEHSRKILGFMAHAKQRKDSFIQFFAMTGILLLSMRSLSQKYKIHGLQEDIHALRVDHGSLTDRINNIKNDLLREASQDSTGLFASRLRHLFAEQH*