SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g02120

Feature Type:gene_model
Chromosome:Gm04
Start:1467377
stop:1470784
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g02120
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G20460AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G76185.1); Has 37 Blast hits to 37 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 37; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:7091505-7092993 FORWARD LENGTH=106 SoyBaseE_val: 8.00E-50ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1JSX6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JSX6_SOYBN SoyBaseE_val: 8.00E-68ISS
UniRef100_Q9LMV5UniRef Annotation by Michelle Graham. Most informative UniRef hit: F5M15.20 n=1 Tax=Arabidopsis thaliana RepID=Q9LMV5_ARATH SoyBaseE_val: 2.00E-06ISS

Expression Patterns of Glyma04g02120
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g02120
ParalogEvidenceComments
Glyma06g02220 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g02120 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g019300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g02120
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g02120
>Glyma04g02120.1   sequence type=CDS   gene model=Glyma04g02120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATAACACGATCGAATCTGGTTGAACAGCTGCGAGAGTATCAGATTCGATCCAAGCATGACTGGGCCTCTGTCTCGTTCTTCTCCTCCACTTCTTCAAACATCACCACTTCCAGGGTGGATGTGGTGCTTTTTGTAATATGGGAACTTGTTATTTTAGCTTTCTTGGTTTTTTCTGTAGTCTCTCTGTACTTCAAGCACATCCGGCTTGCTTTTATTTTAGTCTGCATCACAATCCTATTGCTTTTATGCATGAAAATTACAAAGCAAGTAAGGCTTGCAAGGAAAAAGAGACGAAGGATGCTTCTTCCATTGTCAATGTAA
Predicted protein sequences of Glyma04g02120
>Glyma04g02120.1   sequence type=predicted peptide   gene model=Glyma04g02120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MITRSNLVEQLREYQIRSKHDWASVSFFSSTSSNITTSRVDVVLFVIWELVILAFLVFSVVSLYFKHIRLAFILVCITILLLLCMKITKQVRLARKKRRRMLLPLSM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo