Report for Sequence Feature Glyma04g01830
Feature Type: gene_model
Chromosome: Gm04
Start: 1223795
stop: 1226034
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g01830
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G35550 AT
Annotation by Michelle Graham. TAIR10: WUSCHEL related homeobox 13 | chr4:16875814-16877167 REVERSE LENGTH=268
SoyBase E_val: 4.00E-74 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
GO:0043565 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding
SoyBase N/A ISS
KOG0484
KOG
Transcription factor PHOX2/ARIX, contains HOX domain
JGI ISS
PTHR24329 Panther
FAMILY NOT NAMED
JGI ISS
PTHR24329:SF295 Panther
JGI ISS
PF00046 PFAM
Homeobox domain
JGI ISS
UniRef100_I1JST9 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JST9_SOYBN
SoyBase E_val: 3.00E-154 ISS
UniRef100_Q9ZRZ5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: HB1 homeodomain protein n=1 Tax=Populus tremula x Populus tremuloides RepID=Q9ZRZ5_9ROSI
SoyBase E_val: 2.00E-87 ISS
Expression Patterns of Glyma04g01830
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma04g01830
Paralog Evidence Comments
Glyma06g01940 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g01830 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g016700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g01830
Coding sequences of Glyma04g01830
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g01830.1 sequence type=CDS gene model=Glyma04g01830 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAAGCAGAGACCTCAAACGGTGGTGGTATTGGAGGCCTTTACGTCAAAGTTATGACCGACGACCAAATGGAACTGCTCAGGCAACAGATTTCTGTCTACGCCACCATCTGTGAACAGCTCGTTGAGATGCACAAGGCCGTCACTACCCAACAGGACCTCGCAGGGCTGAGGCTGGGTAATTTGTACTGTGATCCGTTGATGGCATGCTCTGGACACAAGATAACTGCGAGGCAGCGCTGGACTCCAACGCCTCTGCAGCTTCAAATACTTGAGCGTATTTTTGATGAGGGAAATGGCACTCCGAGCAAGCAGAAGATCAAAGACATAACCATTGAGCTGGGCCAGCATGGCCAAATATCAGAGACAAATGTTTATAACTGGTTCCAGAATAGAAGAGCTCGTTCAAAGCGGAAGCAACTCACTCCTGCACCCAATGTTGTGGAGCCAGAAGTTGAGTCTCCAAAAGAGAAAAAGACTCGTGCAGAAGGCTTTCAGGTTCAACCCTATGAGAATTCATCACCTCATAGGATCAAGGATATGTACATCCAGAGTCCTGACATAGGATTTGACCAATTACTGGGTAAAATAGAAGTTGCAAGCTGCTACAGTTCTTATTTTCTTTGA
Predicted protein sequences of Glyma04g01830
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g01830.1 sequence type=predicted peptide gene model=Glyma04g01830 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEAETSNGGGIGGLYVKVMTDDQMELLRQQISVYATICEQLVEMHKAVTTQQDLAGLRLGNLYCDPLMACSGHKITARQRWTPTPLQLQILERIFDEGNGTPSKQKIKDITIELGQHGQISETNVYNWFQNRRARSKRKQLTPAPNVVEPEVESPKEKKTRAEGFQVQPYENSSPHRIKDMYIQSPDIGFDQLLGKIEVASCYSSYFL*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
