Glyma04g01640 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g01640

Feature Type:	gene_model
Chromosome:	Gm04
Start:	1088617
stop:	1090419
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g01640

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G20850	AT	Annotation by Michelle Graham. TAIR10: xylem cysteine peptidase 2 \| chr1:7252208-7253537 FORWARD LENGTH=356	SoyBase	E_val: 0	ISS
GO:0006508	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis	SoyBase	N/A	ISS
GO:0010075	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth	SoyBase	N/A	ISS
GO:0010623	GO-bp	Annotation by Michelle Graham. GO Biological Process: developmental programmed cell death	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0008233	GO-mf	Annotation by Michelle Graham. GO Molecular Function: peptidase activity	SoyBase	N/A	ISS
GO:0008234	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cysteine-type peptidase activity	SoyBase	N/A	ISS
KOG1543	KOG	Cysteine proteinase Cathepsin L	JGI		ISS
PTHR12411	Panther	CYSTEINE PROTEASE FAMILY C1-RELATED	JGI		ISS
PTHR12411:SF44	Panther	CATHEPSIN L-RELATED	JGI		ISS
PF00112	PFAM	Papain family cysteine protease	JGI		ISS
PF08246	PFAM	Cathepsin propeptide inhibitor domain (I29)	JGI		ISS
UniRef100_Q6Y1E9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cysteine protease 14 n=1 Tax=Trifolium repens RepID=Q6Y1E9_TRIRP	SoyBase	E_val: 0	ISS
UniRef100_UPI000189D9E0	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000189D9E0 related cluster n=1 Tax=unknown RepID=UPI000189D9E0	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma04g01640

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g01640

Paralog	Evidence	Comments
Glyma06g01730	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g01640 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g014800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g01640

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g01640

Limit To All Plant Sequences

>Glyma04g01640.1   sequence type=CDS   gene model=Glyma04g01640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTTCTCCTTCTCCAAAGCACTTGTCCTTGCCTGCTCCTTCTGCTTATTTGCGTCTTTGGCTTTTGGACGCGATTTCTCCATTGTGGGCTATTCATCGGAGGACTTAAAGTCCATGGATAAGCTCATTGAACTCTTTGAATCATGGATGTCAAAACATGGCAAGATTTACCAAAGCATTGAGGAGAAGCTTCTTAGGTTCGAGATTTTCAAGGATAACCTAAAGCACATTGATGAGAGAAACAAGGTGGTCAGCAACTACTGGCTTGGCTTGAATGAGTTTGCTGATTTGAGCCACCAAGAGTTCAAGAACAAGTATCTGGGGCTTAAGGTGGACTACTCTCGAAGGAGAGAGTCTCCTGAAGAATTCACTTACAAAGATGTTGAATTGCCTAAGTCAGTGGATTGGAGAAAGAAAGGTGCTGTGGCCCCAGTCAAGAACCAAGGTTCATGTGGTAGCTGCTGGGCATTTTCCACTGTTGCAGCAGTTGAGGGTATAAACCAGATAGTCACGGGAAATTTGACATCACTGTCTGAGCAAGAGTTGATTGACTGTGACAGAACATACAACAATGGTTGCAATGGGGGTCTCATGGACTATGCATTCTCCTTTATTGTAGAAAACGGTGGACTCCACAAAGAGGAAGATTATCCTTACATTATGGAGGAAGGTACTTGCGAGATGACTAAGGAAGAAACCGAAGTTGTCACCATTAGCGGGTACCATGATGTGCCACAAAACAATGAACAGAGCCTATTGAAGGCACTTGCAAACCAACCCCTCAGTGTGGCCATAGAGGCTTCAGGCAGAGATTTCCAATTTTACAGTGGGGGTGTTTTCGACGGGCATTGCGGAAGTGACTTAGATCATGGTGTGGCAGCTGTTGGATACGGAACTGCGAAAGGTGTGGATTATATCATAGTGAAAAATTCATGGGGATCTAAGTGGGGAGAGAAAGGATACATAAGAATGAGGAGGAACATTGGAAAACCCGAGGGAATCTGCGGTATCTACAAGATGGCTTCTTATCCCACTAAGAAGAAATAA

Predicted protein sequences of Glyma04g01640

Limit To All Plant Sequences

>Glyma04g01640.1   sequence type=predicted peptide   gene model=Glyma04g01640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAFSFSKALVLACSFCLFASLAFGRDFSIVGYSSEDLKSMDKLIELFESWMSKHGKIYQSIEEKLLRFEIFKDNLKHIDERNKVVSNYWLGLNEFADLSHQEFKNKYLGLKVDYSRRRESPEEFTYKDVELPKSVDWRKKGAVAPVKNQGSCGSCWAFSTVAAVEGINQIVTGNLTSLSEQELIDCDRTYNNGCNGGLMDYAFSFIVENGGLHKEEDYPYIMEEGTCEMTKEETEVVTISGYHDVPQNNEQSLLKALANQPLSVAIEASGRDFQFYSGGVFDGHCGSDLDHGVAAVGYGTAKGVDYIIVKNSWGSKWGEKGYIRMRRNIGKPEGICGIYKMASYPTKKK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain